CAZyme Information: TREMEDRAFT_37785-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_37785-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		44884.06	8.7889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711529:1451737-1453431(-)

Full Sequence      

MHALYYLLPLLPLTLANPSNPKARHVTNLNPHTARHLVRSPRVDEAMAATAMLARDGTNS
DSHQKRKVSVKGHTAQRMIRRRKRASCVVPPTPSSSSFDAKLAAPVPSTSPRTNSSTSLS
VQDVQTSSSMTSSTPASTPSTNSTTPSGNTGKMGAVMPLSTKDYWTTSTDSGNAMSFNDA
LNPLFAGKMPSSTTAPDGSTALVATYPAGIYGLSGSGFNFYTEGIHSNVDVTSANEVLLS
YSVFFEDGFDFNKGGKMPGFFGGTSLDSAKTCSGGRQDGRSECFSARLMFRTNGMGEFYN
YFPTSATQPTGYCSTPPMSTCNPDYGDSIGRGSFNWTPGQWVTVAQRLKMNDVGQKNGEQ
ELFVNGKSVLSLSNLEIAVEEGTKVYGIMAQTFFGGSGSDWASPKDQSAYFKDWTLAVLS

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_37785-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	198	416	2.7e-107	0.9953917050691244

CDD Domains     

TREMEDRAFT_37785-t26_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE10038.1|PL14_4	7.67e-145	1	420	1	409
AUB27086.1|PL14_4	4.60e-101	165	420	259	499
AFR97104.1|PL14_4	4.60e-101	165	420	259	499
UOH83410.1|PL14_4	9.18e-101	165	420	259	499
AAW45360.1|PL14_4	9.70e-100	165	420	257	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	1.35e-31	191	420	48	274	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
3A0N_A	7.41e-06	191	416	29	240	Crystal structure of D-glucuronic acid-bound alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_A Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_B Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3IM0_A Crystal structure of Chlorella virus vAL-1 soaked in 200mM D-glucuronic acid, 10% PEG-3350, and 200mM glycine-NaOH (pH 10.0) [Paramecium bursaria Chlorella virus CVK2]

Swiss-Prot Hits     

TREMEDRAFT_37785-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.703853	0.296158

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_37785-t26_1-p1.