CAZyme Information: TREMEDRAFT_34261-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_34261-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		52018.49	3.9905

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711539:683936-686713(+)

Full Sequence      

LTTSVLYPILYIYLGKTTSTLGAYNLGGINATGQIPSIGPFQLIDKDTPSSAYTHTSLET
GDQWELIFSDEFNTAGRTFYEGDDPYWQAVDLHYWQTNNLEWYDPSRLTTKDGSLIVTLD
KFENHNLNYQGGMMSTWNQFCYTGGYVEASVSLPGTSTVYGLWPAIWAMGNLGRAGYGGT
LEGLWPYSYDSCDVGTLPNQTLNDEPEVALTQGDPDHGYILSYLPGQRLSSCTCPDDPTH
PGPKRPNGSFIGRAAPEIDMFEASFQVDANTLKGEVSQSGQWAPFNPNYYFVNNSKTYQV
YDEDTTWMNTYQGGVYQQATSGLTFTDQVGLIFDTGGTGCYSVYGFEYSPGVDGYITWVA
DGKKAWTVRGGAMAPNAEAGVGQRMVSEEPMYLIINLGLSENFGAIDSSFPQTCIELTDA
EDPNKRSIGCDPVDRPTAKYISLYPEAYADPNITTFAEIPDAVLPKNRLVDTC

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_34261-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	70	408	1.2e-124	0.9447852760736196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	5	473	58	500	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	9.32e-132	66	413	1	285	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	3.55e-34	43	413	29	332	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.08e-12	68	413	1	226	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	5.31e-05	302	413	109	199	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75891.2|GH16_2	4.26e-210	8	473	411	880
AUB26017.1|GH16_2	1.11e-204	8	473	410	879
AFR96134.2|GH16_2	1.11e-204	8	473	410	879
ADV23033.1|GH16_2	7.41e-200	8	455	411	862
QRW12031.1|GH16_2	3.32e-189	7	473	184	653

PDB Hits     

TREMEDRAFT_34261-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13941|YEPB_SCHPO	4.49e-99	43	473	218	627	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P32486|KRE6_YEAST	1.32e-90	43	473	306	711	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87023|KRE6_CANAX	2.86e-90	43	470	331	738	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13789|YEOB_SCHPO	1.84e-87	43	473	223	636	Uncharacterized beta-glucan synthesis-associated protein C17G6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G6.11c PE=3 SV=1
sp|P87024|SKN1_CANAX	3.18e-87	43	470	335	735	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.985841	0.014178

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_34261-t26_1-p1.