CAZyme Information: TREMEDRAFT_33764-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_33764-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659	JH711538|CGC3	70966.71	4.1749

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711538:1017795-1019930(-)

Full Sequence      

MSLTSLLSLLPYLVFIAASPFTLDDRIWDRANTPTPLSFSPSGDAGISAQQMFLGTNKKV
YILDKTENNPVNVTGKYGTHPAWAVEYDLATNTYRTMDVDSNTFCACGGVLANGTWAIFG
GNQPITTGGVATTDQGAYHDTDGGTAIRLINPCNDQSCEYIQGDQPFQVSEGDTGGYLQM
TGRRWYPTVEALPDGSLIIIGGDKNGGYVNTPAQDNPTYEFFPPKGDGNAVNLQFLSDTL
PINLYALTWLMPSGRLFMQANRKSILYDYESQETTNLPDMPFAARVYPASAATALLPLTP
DNNYTATVLFCGGSANEQWGNDGGPGFNITAVQADNTCVRISPDDDNPQYEQDDYMFESR
SMGQFVILPDGTFWFGNGVEYGTAGYGPPYYSTGQSYGQAPVYWPAIYNPSAPKGGRWNR
TGLSPSQNERMYHSTAILLPDGSVFISGSNANADFTNDQWRSRTDTERWYPWYFNLARPT
YSGMPSTISYGGESFDLVIAGLTDENTVKNTKVVLIRGGFNTHAIGFGQRYLQLENSYTI
DMESGNTTLHVSQIRGNPGPTLFQPGPALFFLVVDGVPSEGDFVMIGSGEIGTQPTTTNA
PLPSSQVKAVQTNTTDDTGSGSGSGSGSGSGSSAGMRLEVGGLVWGTGCMVVLGLMVMV

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_33764-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	34	607	5.5e-218	0.9893428063943162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	8.75e-50	57	313	8	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	8.33e-22	485	586	3	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	6.16e-18	473	586	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
271234	Sialidase_non-viral	0.006	322	499	95	267	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOH82708.1|AA5_1	0.0	1	610	4	619
AFR95790.1|AA5_1	0.0	1	610	4	619
AUB25635.1|AA5_1	0.0	1	610	4	619
KGB79344.2|AA5_1	0.0	35	612	40	614
ADV22716.1|AA5_1	0.0	18	610	30	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	1.29e-13	184	586	257	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	6.20e-12	184	586	246	603	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	6.25e-12	184	586	251	608	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
2EIC_A	1.03e-07	356	586	435	637	Chain A, Galactose oxidase [Fusarium graminearum]
1T2X_A	1.03e-07	356	586	435	637	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	1.62e-65	45	589	35	552	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	7.28e-48	82	586	156	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|Q3HRQ2|GLOX_VITPS	1.03e-46	82	586	74	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	4.70e-35	44	586	76	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	2.49e-33	54	603	437	922	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003720	0.996240	CS pos: 18-19. Pr: 0.9496

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_33764-t26_1-p1.