CAZyme Information: TREMEDRAFT_33542-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_33542-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		26447.12	3.8739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711537:569281-570299(+)

Full Sequence      

LQAIQDTKTNLTVWPAIYVDSNETAYEAQVTALSDALTTYGVDNVEGVIVGNEYILNTAG
SSTNTSASYLTAVETITSKVADVKSKLSALSLSKTLQVGTADAGSILSTTLAEGIDFYMA
NVHPYFGSVAIQDAATWTTEFFGNFDTSVAATASNQPASFIAETGWPTQSMDKKDASDGA
GSPQGDASVANLQTFLDTFVCQATTNGSAYFYFEAFDEPWKAQFGGVEPYWGLFDSDRNL
KKITIPQC

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_33542-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	9	241	3.8e-29	0.8360128617363344

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.19e-26	8	238	102	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.92e-08	48	241	89	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25740.1|GH17	1.18e-121	1	248	1	248
AUB28743.1|GH17	1.77e-119	1	248	248	495
AFR98574.2|GH17	1.77e-119	1	248	248	495
AAW47222.2|GH17	2.44e-119	1	248	247	494
UOH85421.1|GH17	2.81e-119	1	248	229	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.05e-18	13	245	94	294	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.77e-17	13	245	94	294	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QN74|BTGC_ASPNC	1.45e-37	9	248	442	678	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|Q4WUK5|BTGC_ASPFU	1.49e-34	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	1.49e-34	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	1.06e-32	9	248	413	649	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|A1DEV5|BTGC_NEOFI	1.18e-32	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000054

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_33542-t26_1-p1.