CAZyme Information: TREMEDRAFT_31854-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_31854-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		90370.73	4.8465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711534:648677-652231(-)

Full Sequence      

MARRIQEWDSAIGTLNPEVAIKITSKVVQAIMSRCPEDAVEITLDVNTRIQILDELSHLA
GARKHQFAAFCRHESCLVVWADEVETLIPSAEALEQRMIAYVWSALEERLREEKSDKTKE
EEAIGAEEGEWEKRDIRPVMLYAPLISGLAIILTFVFIGSGMRNLIKESLLDGSYVRMAL
LATSPFGYLLAIFFSICVCGNLWQAFGPVAHCHQNSSYYSGKTPTRMTGTLPHITIQMPV
YKEGLEGVIIPTVESLKKAITTYERQGGSVNIFIYDDGMQIWDEEEQEIRKAYYDRNNIG
WTARPKHGANGYIRKGRFKKASNMNFGNRLSLRVEEIMDELRPEPPADDPLALATWQWTD
EDEMEIYEEALAKALDETNGIAWAAGNIRIGGIILIIDSDTRVPEDCFLDAASEFASSPN
IGIIQHESAVMQVVGHYFENAITSFTIRINSAISFCAANGEVAPFVGHNAFLRWRAIQDA
AFVDPDDGLTKCWSETHVSEDFDQALRLQMKGWSLRWASYSNGGFQEGVSLTCDDELNRW
QKYAFGCSELLFQPLRYWFTRGPITPLFHQFVWADGIPLHSKISVLAYISSYYAIACALL
LSWLNWILIGLFNDNLDLFYLESWQVFLTCIVIFCGLSNISSAIFQYRLNTNSLGNALIG
NFKWIIFFFFFFCGMSYHLTTALIAHLVGYNMQWASTIKEVELSHFFKEWPLMWKRFWTV
WILSWIQILGVAFMASSLVPVGYRITNFTAILPLMAQSACHFLYPIVLNPWCEFLFRGDE
RWEADDVVLLFQF

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_31854-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	393	607	3.8e-55	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.10e-47	398	604	6	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.13e-04	398	645	145	373	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
225494	MdoH	0.004	398	539	248	388	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
133034	Glucan_BSP_MdoH	0.008	398	546	103	250	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ81467.1|GT0	0.0	1	771	173	975
CED83368.1|GT0	0.0	5	771	226	1055
ACZ81448.1|GT0	1.07e-270	5	771	130	940
CCA68526.1|GT0	6.44e-249	5	771	53	865
CDR88141.1|GT0	9.55e-234	4	770	43	860

PDB Hits     

TREMEDRAFT_31854-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TREMEDRAFT_31854-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

Start	End
139	161
181	203
586	608
623	645
666	688
717	739