CAZyme Information: TREMEDRAFT_30675-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_30675-t26_1-p1
• CAZy Family: CE17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		49681.78	9.8962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711532:583308-585078(+)

Full Sequence      

MSSILTTPRIIALSAFIHVTLLLYANHVDTHPERYGGLKYTDVDWRVVSDGAKLIFSPTL
ENRAQGWLVNKLDLNFGNPYERATFRYTPLLPLLLSPSILHPFLGKLILVVASLIIPILL
LRLNQIRNPLFWPTHLIWTLNPFVLNITTRGSPEAIICLLVTALLFSLKSAESTSLSKDR
SRPTRAAVLLALAVSYKIYPLIYVPTIWATLARRYGWFGWGVWRFGMVTLISMIIVNGLL
WSIWGQPFLDHTFLYHLTRLDHRHNFSPYFYPIYLSYFPTQNGISSSWPHSWIKPMLFLL
EHPLISFLPQATLMLLVGFAFGSLEGGLELGMFVQTWGFVIFNKVCTSQYYTWFLPLLSP
LIPHLHITSRRAILLSTSWITAQALWLGMAYQLEFLGWAVHLWVWAAGLVLVAVSVWVLG
EIISAYTLRPVMKTE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	147	423	1.1e-71	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
252941	Mannosyl_trans	7.32e-55	147	423	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
178434	PLN02841	4.19e-45	2	430	3	422	GPI mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75735.1|GT50	1.28e-165	7	426	6	411
AAW41613.1|GT50	2.49e-165	9	435	8	420
UOH81399.1|GT50	5.00e-165	7	435	6	420
ADV19492.1|GT50	1.53e-164	7	426	6	411
AUB22890.1|GT50	3.31e-163	7	435	6	420

PDB Hits     

TREMEDRAFT_30675-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	9.49e-56	6	424	10	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7T310|PIGM_DANRE	2.47e-55	28	430	22	386	GPI mannosyltransferase 1 OS=Danio rerio OX=7955 GN=pigm PE=2 SV=1
sp|Q5F380|PIGM_CHICK	9.57e-54	19	426	20	405	GPI mannosyltransferase 1 OS=Gallus gallus OX=9031 GN=PIGM PE=2 SV=2
sp|P47088|GPI14_YEAST	4.13e-50	13	424	11	387	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q54IA4|PIGM_DICDI	7.01e-50	7	423	25	427	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.847703	0.152311

TMHMM  Annotations     

Start	End
99	121
186	208
223	245
304	326
336	358
371	393
403	425