CAZyme Information: TREMEDRAFT_26330-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_26330-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	JH711528|CGC16	65103.44	6.9396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711528:3058608-3061095(-)

Full Sequence      

MLTSNQIIWKSHQMPQHTYLSNGLLKVNPSGRHPIYDLIARSREDWNTKGSSQSRTLNEA
VSEYRRRYGRAPPKAEFFGGTTELMDGWAYVKKHNVQLPDEYDQIYDDIEPFFALTAERI
KESVKIAKAKQGIYTIVCQKVETATGRSSECSYNLKEEGMHSDGQRIPRQRAEAQLSLLK
DVESELEEVEAIFYSHDGPFHIVDDEHLTQDIVGAYGADNDQTRASKLGWASACPTDTPL
RVQYDLSVLPTLEQIWNGEKSFVWNHKATMNPCEHPTLAHLSGALAAHGKGVTASKILFP
VLAMCKTPLHSDILAVAMEAWTEDVDVDPPWEEKSDDRLLWRGSTTGIHFGPKTPWNISQ
RINLVSKGNQTTGMLEVFDVRDETFRVGTPSTREIAKLNHDLLDVAFAGRPAQCEQPTCD
EMAKNYRFEPWLSRAEGNKYKYILDVDGNGWSARFKRLMTTNSLIFKATIFPEWYTARVQ
PWVHYVPLKADLTDMYDVFSFFRHNDHLAKEIATAGKIWSKTFWRHEDMVAYQFRLLLEY
SRLLASDREKASYHGKGRRDRSSVKRREG

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_26330-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	296	544	1.3e-61	0.904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.37e-25	300	547	32	256	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.17e-13	439	544	215	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV89460.1|GT90	2.44e-159	13	554	113	650
QRW03676.1|GT90	5.51e-158	13	554	113	650
QRV74770.1|GT90	5.51e-158	13	554	113	650
CCA67199.1|GT90	5.35e-150	12	549	85	619
QRW17661.1|GT90	4.15e-116	10	535	108	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.52e-15	439	545	236	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	8.80e-12	439	544	271	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.30e-81	20	549	139	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	2.44e-15	439	545	264	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.04e-14	439	545	264	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.85e-14	439	545	264	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q8BYB9|PGLT1_MOUSE	1.04e-13	439	545	264	371	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_26330-t26_1-p1.