CAZyme Information: TREMEDRAFT_22618-t26_1-p1

Basic Information

• Species: Tremella mesenterica
• Lineage: Basidiomycota; Tremellomycetes; ; Tremellaceae; Tremella; Tremella mesenterica
• CAZyme ID: TREMEDRAFT_22618-t26_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		36226.19	4.4297

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmesentericaDSM1558	8309	578456	1	8308

• Gene Location: location=JH711538:64575-66519(-)

Full Sequence      

ALLYRYRQQQSVNLGSWFVQEQWMNPSLFNCASGNQQAELDVASGWGGVGNSKQVLERHW
DEWITEDDFSWLKSVGINTVRLPIGFWSLGPDYCKGTVFEDVSDVYSNAWPRVVRAINWA
EKYGLGVLVDLHGAPGSQNGQSHSGVSDGHQNLFDNPTNVALTMNALTFLTQQLVKVNNV
VGIELLNEPSNVDGLTSFCKQLSPEAAAFPFYINDAFDLNRFSDYLSTRTDFVVLDHHSY
FVFGDQPSQQTPVGQIDATLLPIHGTLSQQLLSVSSSARRNLVIDEFSCALTASALANSP
DETADRRAFCTGQIETYANTTAGYSFW

Enzyme Prediction     

No EC number prediction in TREMEDRAFT_22618-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	56	327	1.1e-96	0.9717314487632509

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.89e-32	2	246	11	248	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	9.43e-05	48	194	7	136	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ98740.1|GH5_50	5.61e-130	3	327	74	402
QRW07957.1|GH5_50	2.81e-126	1	327	49	381
QRV79062.1|GH5_50	3.97e-126	1	327	49	381
QRV93739.1|GH5_50	1.91e-124	1	327	49	381
CDI52106.1|GH5_50	1.65e-95	1	327	142	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.91e-36	10	244	10	253	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	7.57e-36	10	244	10	253	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	8.25e-36	10	244	15	258	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PB1_A	8.40e-36	10	244	16	259	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	8.40e-36	10	244	16	259	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	5.60e-53	3	327	8	329	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P29717|EXG1_CANAL	4.13e-35	10	244	54	297	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q12700|EXG_SCHOC	3.15e-31	12	244	45	285	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|O93983|EXG2_WICAO	3.23e-31	10	244	43	283	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q96V64|EXG_BLUGR	8.43e-31	10	256	38	286	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in TREMEDRAFT_22618-t26_1-p1.