CAZyme Information: TPX55023.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX55023.1
• CAZy Family: PL14
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1064		117934.54	6.6505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000001:163844-167710(+)

Full Sequence      

MDCRGATADRDPDHYPSAPEMEGAEAPQVSSVHEGPGQTPFRLPGRLLIASLFLPFTVLE
EPIPSTSSSPASSPTTTHTAQGGLHHAPTSKSDAAIRRLTRSNTSPFLAPTHWQLTVTSH
DHSQPSPPTAFTVYPSALGNIGLQNAVRSVSDQLGSVYWIGLTGCHTDGYNNTKRDAIKL
KLEEYMCVPVFPTDEEVEGHYHRFCKQVLWKPFHYQLPEYPKAQSYEANAWKHYMAVNES
FVQTLTDIYQEGDTIWINDYHLMLVPSLLRQKVPTARIGFFLHIPFPSSEIFRCLHMRRD
LLQGLLGADLIGFQTYSFMRHFLMTATRILGLESTPRGILLDNSSVSVGIFPIGINFAAL
NEKSRNPEVSEMVASLAQRYVGMKVLIGRDKNDYVKGVRQKLLAYEQFLHLHPEWVGQVV
LIQVALPTTEANETEAQVQDVVARINSRYGSIEYIPVVYFQQEISFSQYLALLIMADACL
ITSLRDGMNLTSHEYIACQSNKKSPLVISEFAGTYGSFASAIRVNPWNISEVVDAIHEAL
TMSEDEKASRWKELSDHVRDHSAQNFVDSFLGQLWHVHDEMQRTMGVSIPRLPVDLVLTD
FIGSSRRLFFLDHDGTICRSGSHDSAETFKLRNLVQELVSDPRNIVYIMSGRTKEALAEF
FHVPNLGLSAESGCFVKWADNVQWETMVPDTNFAWKQNVLEIFEYYTDRTPGSSIEMKEA
SIVWHFGNSDPSFGSWQASECHNHIEGALGSLFPIHTLLKKRQLEILPRSVNKGTIVRRA
LEHHQQHHSPRIRRSTSPNFKSSPGYSSSSPSRHSKPHTSHTPPHVSFPHRHQTVSTIDF
VFAVGDDRADEYMFEFLHQVEQDSHHVPSSQPDIPYLSARSVGSATPIPTDLPSHATETT
KGSSTVFTTGSNSAMPPSESTPTQSTMYILQTPTPRSPRIQQQPPMPPVQNIVTCTVGSK
ASNAKYYMSSVSDVLSLLDSIANTGKRGSSLRRSKSGGSGTAESGSDVESRWANGADAMT
TGNQDRGGTADSGSWSSTAVEGSDRNISVGSLGFGVVGVNTICP

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	139	574	2.1e-162	0.9157894736842105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	132	575	19	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	113	571	8	465	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	0.0	142	857	29	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	2.12e-165	142	574	45	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	2.73e-165	159	984	138	929	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09009.1|GT20	2.93e-212	131	859	165	851
AMJ52388.1|GT20	3.02e-194	119	861	120	804
EGX50369.1|GT20	8.72e-188	121	867	164	880
QRW17916.1|GT20	4.16e-178	97	805	153	874
UNI17137.1|GT20	6.88e-178	130	862	162	869

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	4.71e-109	184	574	68	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	1.60e-107	134	574	33	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	1.54e-105	134	574	32	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	8.08e-104	134	575	25	468	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	8.08e-104	134	575	25	468	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	4.05e-153	147	772	47	665	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|O14081|TPSX_SCHPO	1.98e-137	131	741	200	833	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|O23617|TPS5_ARATH	1.07e-134	164	984	108	842	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q9UUI7|TPSY_SCHPO	4.41e-134	131	715	163	760	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|Q9LMI0|TPS7_ARATH	1.38e-129	157	855	102	787	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998480	0.001512

TMHMM  Annotations     

There is no transmembrane helices in TPX55023.1.