CAZyme Information: TPX54300.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX54300.1
• CAZy Family: GT76
• CAZyme Description: chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		29943.85	3.9472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000007:114681-115631(-)

Full Sequence      

MDLLLPVMITIAIALASRAYADNPCAVPTDCALNASQKALTQQLTAFYDFGVTTLPYCQC
SDLLDGNGMTCGFAGFTSESGSLLTVMRYYSQSVPDNIFLADISALQDLAAANSGDSALL
TDLPKNWFSVCLSDPLFIAAQKSANDERVYNPSQAAADTLGLKYALSRAAMYDAFMQQGA
NTTNPDSVWPCIANATAQVGGTPAGLNGTNTYVDEVTWLKAFLQARRDATLNPVNLALAA
SWASTVGRIDSVMYVLYNGDVNFANTSVSTLDVFGIPTIISL

Enzyme Prediction     

EC	3.2.1.132:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	33	261	1.6e-32	0.9774774774774775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381600	chitosanase_GH46	1.53e-41	37	262	3	217	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.
396099	Glyco_hydro_46	1.60e-29	61	229	21	178	Glycosyl hydrolase family 46. This family are chitosanase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBO56277.1|GH46	1.15e-37	33	262	3	224
AOY04287.1|GH46	2.42e-37	33	262	32	253
AOA55440.1|GH46	2.81e-37	33	262	38	259
QGI09928.1|GH46	2.81e-37	33	262	38	259
QGI27581.1|GH46	2.81e-37	33	262	38	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7C6C_A	7.87e-39	33	262	3	224	Chain A, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]
7C6D_A	3.08e-38	33	262	3	224	Chain A, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]
6LWU_A	8.80e-38	33	277	3	241	Chain A, chitosanase [Gynuella sunshinyii YC6258],6X2Q_A Chain A, Chitosanase [Gynuella sunshinyii YC6258]
1CHK_A	2.29e-13	57	231	32	195	Streptomyces N174 Chitosanase Ph5.5 298k [Streptomyces sp. N174],1CHK_B Streptomyces N174 Chitosanase Ph5.5 298k [Streptomyces sp. N174]
4ILY_A	1.74e-12	57	226	45	203	Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILY_B Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O07921|CHIS_BACSU	9.84e-38	33	262	38	259	Chitosanase OS=Bacillus subtilis (strain 168) OX=224308 GN=csn PE=1 SV=1
sp|P33665|CHIS_STRSN	5.44e-13	57	231	72	235	Chitosanase OS=Streptomyces sp. (strain N174) OX=69019 GN=csn PE=1 SV=1
sp|P48846|CHIS_NOCSP	2.22e-11	57	258	73	255	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000183	0.999773	CS pos: 21-22. Pr: 0.9708

TMHMM  Annotations     

There is no transmembrane helices in TPX54300.1.