CAZyme Information: TPX52788.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX52788.1
• CAZy Family: GT48
• CAZyme Description: DUF1752 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A507DPH5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1418	QEAN01000028|CGC1	161028.33	7.1021

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000028:37730-44138(+)

Full Sequence      

MKMVLPLSQPVLTLKLDNLTKMENIDVDELSTIWSVFTKTKDNLENGRRLENLSWRLWTT
VSPSSFHKMLDAATTRGTLELDKFRRVVDSKNLRKGPADSSSIVDGEAPPPSSRVARARA
TASVAPQQFKPASLSRSLPRHSPRTLSQSQTCHNSNVKSSVQATTRSLLQEQLRMLQHQR
HQQQLLKKRNPLAPLSPNHSRNTSINGNHVRNSSSSSSNAIPNRSLSAQSPSPIVNGINS
HTTPSHFDDPSRKVTFFISESSPDSPQDSSKLQRQMLQLQHNHSQADLALRLLQQQHEST
MLLHSSVHQEQQMSIPPLTYNDDNHDYDDDDDISDDDDDDISEDDDDISDESDFESDLSN
STPTSPHKRSNLFQKVDVPASPRLHDAQGRGNDSSGSSSIPRIGGGASRTSLSLLSRAIE
NSELKRAKPSVFSGLARIVAGDSVAPPLLVIPNEADLPPPPMVELSESLRQNLASERRMP
FGAVIARGDFWSNGNEAFRVADSYSELSGWIAAARRRWLPHSFRYLLAAALLICVLQYFL
FSGTVPSAGPKQKAVILLLVRNEDLPDLIETLDNFEKRFNHRFHYPYVMFNDVPFSSEFK
TTVKLHVSASVDFAITDNFNFPSHINVTEAKLSMKAQTVPHGNSSAYHHMCRWFSYPFSL
HPILAEVDYYWRLEPHVVFYCDINYDPFAFMAVHNKLYGFQSFALETMLTIPTLWPETKK
YINMKNIEPPSSFLDDVVVKALDKPNDWNETLEFCTFYNNFEIVNLGLLRSKQNREYFEF
LDSTNKFYFERWGDAPVRSLFVGMTLPREQIHYFGDIGYEHDPDKRFVCHKSKDPSCTCM
KGPIPVPPQNRKLYRMNICVEKYLSTYPPIDHYLMYLALNLLVLNDNVYYIIHLPNIIMG
NAHSNDSSRNRKQGAHVGWRLAVWNRVRQRSTKLIILAFFIVQLLALLIRPLLLSRPSPI
PQPPTPPCPISKPPPVPLPSFDQADKRLQTQARSHISIEHYQPNPYIFNCLAFIHDIFFR
DVDSQIVLIGPGFPDSFGTMKNTTFYVDGAATKVKLQGHSFATYVGYLHVKGLEGQESVK
VEAPSIGLSMRLNRMKGSNLILPNAKVGLQTLVTGSIDLLPSWISYHHKIGIDVILLYDN
RIADYYDDNYDHNAIGSSDITVQLTKLLKDHERPLTIIVWSWPFHFWEYMEPGPMNTART
TSQNHALQYFHDGLEWIAFLEADEYLVPRTHDTASAWLDTISSKYAALTLESVRVECCPM
QNRNFSYDTILETHTMRRLESDGRFMAQRHIGRPIQTTLMHTEWVADATGLVMFVDPNIA
WFHRYYVMTDSATCDAAELVQDTRALELWKGVVESTTLRQSRETVTRPRLSTKTLGSDWS
EPSSVLCVHFEFTRNTLDLISLGQLQRGKASIRKNGHD

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	551	822	3.7e-87	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	5.71e-98	550	865	79	388	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	5.68e-88	541	823	30	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.
400731	DUF1752	7.70e-11	33	58	1	26	Fungal protein of unknown function (DUF1752). This is a family of fungal proteins of unknown function. This short section domain is bounded by two highly conserved tryptophans. The family contains MKD1 that is thought to be a negative regulator of RAS-cAMP pathway in S.cerevisiae. the Sch.pombe member is a GAF1 transcription factor that is also associated with the zinc finger family GATA pfam00320.
396317	Glyco_transf_92	5.78e-06	1123	1325	23	210	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
404573	Glyco_tranf_2_4	7.46e-06	1118	1232	5	90	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS04523.1|GT15	3.64e-68	551	845	65	360
AGO13612.1|GT15	2.98e-66	551	823	113	382
AYO41554.1|GT15	1.17e-64	549	822	47	324
QLG71781.1|GT15	3.08e-64	549	842	133	427
CAE7186283.1|GT15	3.18e-64	546	842	78	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	8.10e-64	551	842	26	317	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
5A07_A	2.05e-58	546	823	98	383	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]
7BOO_A	3.61e-56	551	842	66	361	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46592|MNT2_CANAL	1.44e-62	546	863	134	445	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|P27809|KRE2_YEAST	5.51e-62	551	842	120	411	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1
sp|P38130|KTR3_YEAST	3.16e-61	549	838	83	383	Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR3 PE=1 SV=1
sp|Q96WW1|OMH5_SCHPO	4.97e-61	547	865	79	413	O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh5 PE=3 SV=2
sp|P87207|MNT3_CANAL	1.13e-59	550	823	70	337	Probable mannosyltransferase MNT3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000018

TMHMM  Annotations     

Start	End
872	894
934	953