CAZyme Information: TPX51974.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX51974.1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496		52466.45	8.3541

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000047:50010-51829(-)

Full Sequence      

MRGYTTFILVLGCISLTSALSTLLMAPQCTDGLKNGQETSIDCGGPTCLACQVGHSCRNH
QDCLSSHCSGKKCVAATCSDAIKNGKETDVDCGGGGACRRCDTGMKCTVDKDCASGRCTR
NVCSNMTKTHSTEQRRAPVTSSGASAIDSTSTVGPPTSLRPLSSPATLSLPQTSVKASAY
AATPTGDPGSVLASATPSSTPKPTTLPTFGAPCVSSCKGTGVRCIDDVCQKSWQAPKWNK
TGNVKSMFDGWKVQLDAGSAGNLIVQNPDASNATDLVLKVKFPVGSRNPAADPRGGIGLY
AAPLQLRNATHITLQYDVYFPSSWNFVLGGKLPGLYGGDTGCSGGASAAACFSSRHMWRV
KGAGECYLYLPLDAQPSSFCKVPPQTICDSDYGISLGRGSFVLKPGHWNTIRQKIALNTF
DSYDEPNTDGSIQILFGLDGKPVKTVIDYQSMVWRLYKNVTALGIQFDSFFGGSDKSYVT
PKTQYLYFRNVSLSAY

Enzyme Prediction     

EC	4.2.2.26:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	276	494	2.8e-49	0.965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223021	PHA03247	6.76e-04	152	208	358	423	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05384.1|PL14_3	4.45e-58	232	493	29	286
CDS02791.1|PL14_3	4.25e-53	233	496	28	288
CDR42571.1|PL14	2.06e-43	278	464	317	498
QRW21322.1|PL14	9.17e-42	278	419	87	229
QRW00860.1|PL14	1.41e-41	278	419	231	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	8.36e-34	272	493	53	270	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
3A0N_A	4.42e-13	277	496	39	243	Crystal structure of D-glucuronic acid-bound alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_A Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_B Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3IM0_A Crystal structure of Chlorella virus vAL-1 soaked in 200mM D-glucuronic acid, 10% PEG-3350, and 200mM glycine-NaOH (pH 10.0) [Paramecium bursaria Chlorella virus CVK2]
6KCW_A	3.68e-06	238	493	10	237	Structure of alginate lyase Aly36B [Chitinophaga sp. MD30]
6KCV_A	8.86e-06	238	493	10	237	Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_B Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_C Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30]

Swiss-Prot Hits     

TPX51974.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999768	CS pos: 19-20. Pr: 0.9785

TMHMM  Annotations     

Start	End
7	26