CAZyme Information: TPX51788.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX51788.1
• CAZy Family: GT3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		59600.38	5.6589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000050:64026-66123(-)

Full Sequence      

MNLMTSTMHLYIPPSRHHHILYTATVLATLLTPAHPDPSRIGQWAVGPSTGVVGIHTALL
PDNHLLFFERFHGLHYPSLYPPNPNTYSSNISQSEISTEMTFNPENPLTSGYVVEHETYS
PFCAGHAQMADGRIFVAGGDGDGVGNGYITDGRKAVRTYASATGWVDIGELSTTRWYPTV
ATLPDGRLLIVGGLSESYIPDDPNRNNPTYELYPPDGRGTVPLEVLLPGYPNNSYPIVMV
LPSQRVFIFSSINSMSININSWDNIITYPPLSKTDIYPSRSFPYLSPSVLLPLRKANKYR
AEIMICGGTYINNTASNLCSRIIPDLGEEAKWVDDEMPGGRVMGDGVLLPDGNVVFVGGA
QEGTADGPAGFSKATNPQYAAHLYNPRTRQWSVLASATIPRLYHSSALLLPDCRVLTAGS
DQQNYANPSLEPFEYRIELFSPPYLFAASRPMITAMPSTISYNSTFQIHTPTSNIEMVSF
IRYSTVTHSTNMDQRFVELEFVQTGKGIVEGTSPLDGSLAPPGNWMVFLVKDGVPSVGET
VLLH

Enzyme Prediction     

EC	1.1.3.9:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	35	542	5e-125	0.366120218579235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	3.45e-29	445	543	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	2.25e-24	455	541	1	89	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
399910	Glyoxal_oxid_N	2.90e-24	151	308	88	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCU38866.1|AA5|CBM18	1.37e-69	33	544	230	751
CDS08707.1|AA5_1	6.32e-66	39	544	39	544
VCU39041.1|AA5|CBM18	1.75e-65	34	541	55	581
GAA99111.1|AA5_1	5.91e-63	43	543	290	806
GAA99112.1|AA5_1	5.98e-63	43	543	291	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	1.82e-30	162	541	244	612	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	1.07e-28	162	541	233	601	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	1.10e-28	162	541	238	606	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
2EID_A	1.01e-23	92	541	197	635	Chain A, Galactose oxidase [Fusarium graminearum]
5C86_A	1.23e-23	40	544	2	483	Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, apo form [Colletotrichum graminicola M1.001],5C92_A Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, in complex with copper [Colletotrichum graminicola M1.001]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3HRQ2|GLOX_VITPS	1.99e-54	42	543	15	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	8.94e-46	34	541	88	612	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	1.22e-41	37	538	63	588	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.76e-38	105	541	467	901	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q01772|GLOX_PHACH	3.22e-31	28	543	13	549	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.905346	0.094665

TMHMM  Annotations     

There is no transmembrane helices in TPX51788.1.