CAZyme Information: TPX51669.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX51669.1
• CAZy Family: GT24
• CAZyme Description: Beta-N-acetylhexosaminidase [Source:UniProtKB/TrEMBL;Acc:A0A507DIY9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		67158.74	5.3121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000051:47004-49405(-)

Full Sequence      

MQMAWMPIYQPMPPYIIPIIPASQNPLNLVPIPYLTRLDDQDEGEDDHDHDQDIIISPTS
SENRSKSSNSTTSCTHRSFSLSSNTTIHYYDTRLSSTALRLSRALGIGGIATTLAVIEKE
HDDQMAHGDEHGHGSSAIADVPPPGIHLLITPSFSHTHIPLSNPTLTAECYELCVRDSHT
ITIKAADPKGVFYGCTSLEQMFETSAASIPLVTIVDGPRFEWRGCHLDCARHFMDVPFIK
RFLELLAYHKINRFHWHLTDDQGWRLESELYPNLTDTGAWRDDADGQARYGGVYTRTDVS
DVVALAGELHIEVVPEVELPGHCTAALARYADPVCAVQDSHAETSYPDLGCTGGPYTVSN
RWGIHADVFCAGNENVFVFLEGVLAEVTALFPSKYIHIGGDECPKDTWEACHRCQKRVSE
HGLRDSGELQSWFVNRIAGFLRSKGKIVIGWDEIHEGGLPEDVIVQSWRDWNGAVGAVRQ
GHQAITSPVSHCYFDWGVKYINLERVYAFDPIPPGIAPSEESLIMGSEACMWTEDAPRNT
VLGKVFPRLLALATKLWTLKQRTDGIPFPDFFETVTMYHIPLRLKRLGVECSDGMSESFK
ARA

Enzyme Prediction     

EC	3.2.1.52:18	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	215	558	2.2e-108	0.9703264094955489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119333	GH20_chitobiase-like	1.32e-167	220	571	1	353	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
395590	Glyco_hydro_20	1.96e-140	220	558	1	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
226056	Chb	6.51e-99	110	570	152	626	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
119338	GH20_chitobiase-like_1	3.83e-93	220	564	1	303	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
119336	GH20_SpHex_like	2.48e-78	220	564	1	321	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKG80795.1|GH20	5.96e-135	181	598	115	517
QKJ99561.1|GH20	6.84e-135	169	589	106	513
AFH50886.1|GH20	2.75e-132	169	558	95	471
AFN74826.1|GH20	9.98e-131	169	572	99	488
AKD05472.1|GH20	3.11e-127	153	568	83	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	1.17e-104	169	571	106	518	BT0459 [Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
3RCN_A	1.39e-87	161	590	70	512	Crystal Structure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7CBN_A	1.69e-82	165	564	74	491	Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
6EZR_A	5.84e-76	162	582	202	629	Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
7DUP_A	8.07e-76	163	575	73	506	Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49008|HEXA_PORGI	5.14e-96	177	582	118	536	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
sp|B2UQG6|H0868_AKKM8	1.15e-81	165	564	93	510	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
sp|P96155|HEX1_VIBFU	1.50e-65	162	553	201	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
sp|B2UP57|H2018_AKKM8	4.76e-55	164	558	53	448	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
sp|Q7WUL4|HEX20_CELFI	4.81e-45	169	568	82	459	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TPX51669.1.