CAZyme Information: TPX51520.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX51520.1
• CAZy Family: GT20
• CAZyme Description: DUF1929 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A507DKW7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562		60642.32	7.0018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000053:43356-45293(+)

Full Sequence      

MAPRILIDQLKMLPLLWIVLTLYIQTSTSIPTYPLSDATPPTTRAMQLVTLKLSAVSTAS
LYNGTIVLWSAQGLGYFTGSTGSQSYYQTVTASPNGSIEIGSLQVMNMQQMFCPGTAMLP
DGSIFVNGGSDVTGTVTYSMATRKWTDSSNMNISRGYNSDVLTTGNKVLTVGGSFSGGIG
KKNGELYDVASGKWTRLDNVLGDVIGGVSKETRSPDPQGLFRSDNHAWLFSYKNVVTGHD
MVLHAGPVSNMYLIDTSVVGGSMTFAGGRGTDTYSMNGNSVMYFPGMILTLGGAEAYGGT
QGDHRQAKNTAYIIDATSVPQNVLPTTTQISSMSFSRAFCNSVILPGGNVFIVGGQTHLH
LFSDVTGVLTPEIFDPSTKRFTTVNVNLTHARNYHSEAVLMVDGRIMISGGGLTYDAHQE
NNTNVHYDAEIYTPSNLVNQPQRPTLSRVTNHKYKSFSNTPNPNLDTPNPILDLDHAPQL
QVSTSNCNNCSYELIRVSSATHGVNNDQLRIPLMVGARRSDYVVLSVASDHYPWVRSGYY
WLFAIDGTGVPSMGAAVQVSRS

Enzyme Prediction     

No EC number prediction in TPX51520.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	47	559	2e-129	0.7925170068027211

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	1.07e-08	494	559	38	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
276965	Kelch	4.72e-08	328	436	39	129	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
401164	DUF1929	1.31e-07	494	559	26	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
276965	Kelch	5.50e-07	121	197	57	135	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	7.77e-07	337	436	1	82	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIV67458.1|AA5_2|CBM13	5.65e-90	48	560	332	806
AIP67557.1|AA5_2|CBM13	1.10e-89	48	560	332	806
ALC03270.1|AA5_2|CBM13	1.10e-89	48	560	332	806
ATE20879.1|AA5_2|CBM13	1.10e-89	48	560	332	806
ATE01305.1|AA5_2|CBM13	1.10e-89	48	560	332	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WQ8_A	4.11e-68	63	561	202	661	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
2EIC_A	1.02e-67	63	561	180	639	Chain A, Galactose oxidase [Fusarium graminearum]
1T2X_A	1.41e-67	63	561	180	639	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
5C86_A	2.08e-67	64	560	26	481	Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, apo form [Colletotrichum graminicola M1.001],5C92_A Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, in complex with copper [Colletotrichum graminicola M1.001]
1GOF_A	5.30e-67	63	561	180	639	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2N3|GAOA_GIBZE	5.77e-66	63	561	221	680	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
sp|P0CS93|GAOA_GIBZA	5.77e-66	63	561	221	680	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	2.48e-06	266	559	640	903	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000439	0.999522	CS pos: 29-30. Pr: 0.9608

TMHMM  Annotations     

Start	End
13	35