CAZyme Information: TPX50495.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX50495.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1498	QEAN01000066|CGC1	165685.24	7.2814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000066:11466-18620(+)

Full Sequence      

MMWSRTTGLLRAQRIPAIAQTARQASAQKSFSTTIAAFGLFKDYVTHLKSTSVEEITPAE
LNAKLTHDPVTGPLPSFHLLDVRETYEWNEEHIPCAVYTGRGCLERDIEGIIPDVQDEIV
VYCAGGHRSVLAADSLQKLGYKNVKSLQGGLGQWKNQGMVSAHSELRKLFRTSDKLLIVH
VRLLLIKQGKEYKILTDPLHPGIEQHEDQTMFGELCVTIAMLVTSAIILSIYLHPPFVLR
QLRHFMDSSILVCLAHHRNYIRQKRTNEKTKTYRIALTIDDAPTCHTSAILDQLREMNAT
ATFFVIKHHVDLLGDEGIKLLERAVLEGHELANHTLYDRPSIHLGAEELRKEIEMVDEVI
NNVMMRVGGGPPVKKWFRPGSGWYSTVTLQTSNSTNHTLTLGCIYPFDPQIKIPWLNAYR
VYWMLHDGGIVVLHDRGWTVACLKKVRKLCEKDQAGVYEFVSLSEAWRGLRAWQCPDYHN
MSDYWAVHERVGMVSPRSRDKAYLNFTHGIPFWRCFALRATRAGCIYERKWLREEGYDEI
GYDAWLSNAYKHKRATLLYPRIVIMPGGDTSSRRESWAATTTTSSSSPSPPPSAPLSPLA
PVQHGDKLRQQLILDPTGIQDSLTLPQAEAIQTSSSSWKLFQSDFILRKDAPPSALPVRP
PLMSPGEKPPALPPRPLPAVPPNKSLDLSSPFEADGIVVHSPEDWTIIRLLPPPFVPHLS
KPSPATQIKTSMLTSFFGGGTSNRGRKASVSTFSSMVPHTPSVCTQDDAVVTLKDLVEAP
KFLVNYVSLLNAKVDIMSYRSSASTVESHLLLTTASLDKIRLEPLQFRSSSISETSPLSS
LATLRSLESQTSLIIQWMSAIQYVVDSIKSTAKTAVMSPNDHVFTRPPRGSSTKAAALLG
LSPNSITNAVVVAAPLQPVHVQTQQHQFVPAEGDCIQLFVRDPHLQQSRTAASLPIPLQR
NNIRTDTMNNGNQNNDSPSPPTSPIITHIPNPMQASGTSPNHSHGKPKGKMFGFSAFGRA
QSADSAIDDRKQKQVEERERVRKAAAEARAAERDDKRLKKKDSSRGTRDTTAISAASKMS
QGVFNSVPNFFRMGGTNKRDVSTDSIGSRSSTNSTLRRIGPKRDSVYVLGGKSAMDIMDG
EIPILLKKCIRLVEEIGLDTEGLYRISGSAATVERLRRLFVSDPEAIHLPSPPEYQNASA
LLDEDLGASNASKQVHRTSSRNSLNDEIHSPTTSSNQLKNAGRSKSSKSLYDNDVHVITG
VIKSYLRDGVGMNGRREPVCTYGLYSAFIRAAKMEEWRDKMISYQDLVHELPSANFATLK
FICEHLSNVASHSSRNRMNIKNLAIIFGPTLLRPAPEEETMAGMMFDMGSQCAVVEALVE
QAEWMFGPIEYEDDDEGVGSNNEAVKIVIQKVGEESRQEEEDENSSATVETDATAVAIAG
QEVIVFSSDSEQGVEVSSAGLDDETQEPGFDIRNAVSDAVQVIPLEQVAPGITVIESN

Enzyme Prediction     

No EC number prediction in TPX50495.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	268	395	2e-16	0.8923076923076924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
200581	CE4_NodB_like_2	6.36e-53	274	465	2	189	Catalytic NodB homology domain of uncharacterized chitin deacetylases and hypothetical proteins. This family includes some uncharacterized chitin deacetylases and hypothetical proteins, mainly from eukaryotes. Although their biological function is unknown, members in this family show high sequence homology to the catalytic NodB homology domain of Colletotrichum lindemuthianum chitin deacetylase (endo-chitin de-N-acetylase, ClCDA, EC 3.5.1.41), which catalyzes the hydrolysis of N-acetamido groups of N-acetyl-D-glucosamine residues in chitin, converting it to chitosan in fungal cell walls. Like ClCDA, this family is a member the carbohydrate esterase 4 (CE4) superfamily.
214618	RhoGAP	9.48e-44	1140	1382	1	174	GTPase-activator protein for Rho-like GTPases. GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases. etter domain limits and outliers.
395495	RhoGAP	1.12e-41	1143	1358	1	150	RhoGAP domain. GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases.
239863	RhoGAP_fRGD1	2.93e-39	1142	1386	16	192	RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins. Yeast Rgd1 is a GAP protein for Rho3 and Rho4 and plays a role in low-pH response. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
238090	RhoGAP	1.34e-38	1143	1380	1	168	RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases. Small GTPases (G proteins) cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when bound to GDP. The Rho family of small G proteins, which includes Cdc42Hs, activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. G proteins generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude. The RhoGAPs are one of the major classes of regulators of Rho G proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO22856.1|CE4	1.10e-34	275	465	73	256
QGA13072.1|CE4	2.00e-34	266	446	44	228
QMW29882.1|CE4	6.12e-34	275	465	49	233
QMW41954.1|CE4	6.12e-34	275	465	49	233
UDD61559.1|CE4	6.12e-34	275	465	49	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GVC_Q	7.31e-22	1108	1387	20	230	Structure of ArhGAP12 bound to G-Actin [Mus musculus],6GVC_R Structure of ArhGAP12 bound to G-Actin [Mus musculus],6GVC_S Structure of ArhGAP12 bound to G-Actin [Mus musculus],6GVC_T Structure of ArhGAP12 bound to G-Actin [Mus musculus]
2OSA_A	3.10e-21	1143	1386	25	202	The Rho-GAP domain of human N-chimaerin [Homo sapiens]
3BYI_A	5.66e-21	1115	1387	8	212	Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15) [Homo sapiens],3BYI_B Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15) [Homo sapiens],3BYI_C Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15) [Homo sapiens],3BYI_D Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15) [Homo sapiens]
1XA6_A	2.05e-20	1143	1386	289	466	Crystal Structure of the Human Beta2-Chimaerin [Homo sapiens]
1F7C_A	3.87e-20	1145	1389	40	219	Crystal Structure Of The Bh Domain From Graf, The Gtpase Regulator Associated With Focal Adhesion Kinase [Gallus gallus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6TLK4|RHG27_RAT	1.62e-23	1109	1388	657	868	Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
sp|Q6ZUM4|RHG27_HUMAN	4.97e-23	1109	1388	677	888	Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
sp|A2AB59|RHG27_MOUSE	6.35e-23	1109	1388	657	868	Rho GTPase-activating protein 27 OS=Mus musculus OX=10090 GN=Arhgap27 PE=1 SV=1
sp|Q69ZH9|RHG23_MOUSE	1.10e-21	1142	1397	915	1100	Rho GTPase-activating protein 23 OS=Mus musculus OX=10090 GN=Arhgap23 PE=1 SV=2
sp|Q9P227|RHG23_HUMAN	4.28e-21	1142	1397	919	1104	Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TPX50495.1.