CAZyme Information: TPX48365.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX48365.1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	QEAN01000101|CGC1	82438.57	6.1110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000101:19634-22398(-)

Full Sequence      

MSRPYWPAPPIMHRSSKPSNIVSKIHLPKHLELEAVCRSGGLLVSSQLLCNLGSPPDQST
LSVVISMLLNLTSICTLFCLLLTHHIAASATVTYVFNITYTYASPDGVNRRVITVNNTWP
PPTIEAMQGDQLVVKVHNSLTEATSLHWHGIHQKGSQVMDGVYQTTQCPIVPGSEYTYNF
TLNQSGTYWWHAHVRASYLDGLRAPLIIHDPADPHRSLYDDDTQILALSDWYHNQSEPML
QEFMSTNNPGGVEPIPDSGLINNLGHFDCSLPTYGMTCNPTQHRYITNPLVNGRRYRIRV
INTSGMATFNFSIDGHQLLVIEADGVPVTPVEVDQLEVAVAQRYSVIVTANQTASNYWIR
ATMNMALFDLKPELDQKIGAVLRYEGAAAVDPTEDLAAHVTPKVVLTDDMLVPVKVQDAP
TTVVSSTTFGFAFMTTYDGDNRAFVFMNNAAPSSYMFPHVPTLQRLAAGLPPLPTINPIN
LTANAGAEIIINNLDGEPHPFHLHGHWFWIVAQGEGVVENGNFTARTKNPPLRDTVMVPA
NGYSVIRWNADNPGAWMFHCHVEWHLMADSLIIPSTVSDLCTTAATFVPTGNEPIREPII
LPDTSKGYAGLPGSTPLLWDVSSCCSETNNGFFQILNALTGWRARPTVLTTCVYFGYWML
VGLGFVVRRMQHYRKMRRHRDEDDSEEDEYSPVLAAASPIFPESIDTSSSGVAKPNASAE
ATLISPLTSPLITSRASWPASHSQVTGGV

Enzyme Prediction     

No EC number prediction in TPX48365.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	108	566	9.7e-115	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.31e-87	94	566	4	513	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	8.25e-87	85	566	17	536	L-ascorbate oxidase
225043	SufI	8.34e-77	90	569	32	441	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
215324	PLN02604	3.24e-74	74	565	7	535	oxidoreductase
274556	laccase	1.25e-65	94	567	6	510	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09935.1|AA1_2	6.63e-111	96	612	32	539
QRC92126.1|AA1_2	1.47e-107	86	566	18	483
CDS03778.1|AA1_2	1.16e-104	86	611	14	533
QQX29065.1|AA1_2	2.11e-98	89	582	18	509
QRW22330.1|AA1_1	4.20e-98	76	589	5	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3KW7_A	7.35e-88	104	583	16	493	Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2],3KW7_B Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2]
6H5Y_A	2.50e-86	104	583	16	487	PM1 mutant, 7D5 [Aspergillus oryzae],6H5Y_B PM1 mutant, 7D5 [Aspergillus oryzae]
5A7E_A	2.50e-86	104	583	16	487	Chain A, CORIOLOPSIS GALLICA LACCASE [Coriolopsis gallica]
6RHH_A	2.64e-86	97	581	10	488	Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Third structure of the series with 315 KGy dose. [Steccherinum murashkinskyi],6RHI_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Ninth structure of the series with 1215 KGy dose. [Steccherinum murashkinskyi],6RHO_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Twentieth structure of the series with 4065 KGy dose. [Steccherinum murashkinskyi],6RHP_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Twenty first structure of the series with 4415 KGy dose (collected after refreezing). [Steccherinum murashkinskyi],6RHR_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. First structure of the series with 15 KGy dose. [Steccherinum murashkinskyi],6RHU_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Second structure of the series with 165 KGy dose. [Steccherinum murashkinskyi],6RHX_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Third structure of the series with 315 KGy dose. [Steccherinum murashkinskyi],6RI0_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Ninth structure of the series with 1215 KGy dose. [Steccherinum murashkinskyi],6RI2_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Twentieth structure of the series with 4065 KGy dose. [Steccherinum murashkinskyi],6RI4_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. First structure of the series with 13 KGy dose. [Steccherinum murashkinskyi],6RI6_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Second structure of the series with 400 KGy dose. [Steccherinum murashkinskyi],6RI8_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Third structure of the series with 800 KGy dose. [Steccherinum murashkinskyi],6RII_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Fourth structure of the series with 1200 KGy dose. [Steccherinum murashkinskyi],6RIK_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Thirteenth structure of the series with 5200 KGy dose. [Steccherinum murashkinskyi],6RIL_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Fourteenth structure of the series with 5600 KGy dose (data was collected after refreezing). [Steccherinum murashkinskyi]
5MEW_A	2.72e-86	97	581	10	488	The study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi. Second structure of the series with total exposition time 33 min. [Steccherinum murashkinskyi],6RGH_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. First structure of the series with 15 KGy dose. [Steccherinum murashkinskyi],6RGP_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Second structure of the series with 165 KGy dose. [Steccherinum murashkinskyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9R598|FETC_ASPFU	1.17e-98	88	566	19	482	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1
sp|Q02081|LAC4_THACU	1.51e-94	87	566	18	488	Laccase-4 OS=Thanatephorus cucumeris OX=107832 GN=LCC4 PE=1 SV=1
sp|K7NCS2|FETC_EPIFE	1.33e-91	86	581	17	514	Iron transport multicopper oxidase fetC OS=Epichloe festucae (strain E2368) OX=696363 GN=fetC PE=2 SV=1
sp|Q99056|LAC5_TRAVI	4.86e-89	104	583	39	518	Laccase-5 OS=Trametes villosa OX=47662 GN=LCC5 PE=3 SV=2
sp|I1RMG9|FET3_GIBZE	2.93e-88	86	616	19	552	Iron transport multicopper oxidase FET3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FET3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999936	0.000104

TMHMM  Annotations     

Start	End
646	668