CAZyme Information: TPX48310.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX48310.1
• CAZy Family: GT14|GT77
• CAZyme Description: Protein xylosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A507DAD4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		70572.60	7.5461

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000102:40442-42661(+)

Full Sequence      

MALLPALVISTDRSPFLRKLQLPATSNPKANSTRIWLVRHTSCLRYAMIVSLAALIVLSI
WMTQSPAGQPIIYADAGQKSLYSQSKNGDLILKIPMSQNDTKRRDEPIFHTDLSKALSKI
EEVELTGFKYCPWLEGATVNPWINLQPMGGNMFQTNPSRGHVASMVDALAKIVANNVATW
TKPTLSQEAIQRFSCRMSIDGTNEWALLADSKWLKHINAAAYFPEMSFGTKSTLDVVTSP
LSAIPSSSSQPIGIKAAHPPRKKYKMAYLVMIHEHPDALAKLLSALYSPSTLILVHLDKG
SSELRPAVEQVIAEKPEYYNNVHVFSQFHIHWGGGSMVMMMLEGFLKLLDLGDWDYAVNL
SGYDYPLLSGDAVHSILERDPGKVYLTHWHDSESARRLDLVFLASADQHFVVRPNAGPDR
SFPFKTTFNPIKHHQWLILPRDYVMYLRTSQDAVDLLGWAEHAWVPDEWYFGMLAMSSPH
WRDRINTRCGRYINFPHNALHPNWIEKRDLAKIARAGLGSYFFARKVWIVGDDRVTKWMD
RWREQGNALVESGKWFGSIAGEPMALSDVPTLESDNISNGVNDVDILSEEWWQQQFVVDG
NSRHHPGISNDGSISGKTSQQSQLQH

Enzyme Prediction     

No EC number prediction in TPX48310.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	267	504	2.3e-42	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396855	Branch	2.36e-13	267	510	2	241	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
178725	PLN03183	1.20e-09	257	447	68	270	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOU96877.1|GT14	1.37e-24	260	526	18	279
UKB81230.1|GT14	4.61e-24	249	526	7	279
AOG05113.1|GT14	1.36e-22	266	540	2	271
AZA67708.1|GT14	1.63e-22	266	526	3	258
AZA51393.1|GT14	1.63e-22	266	526	3	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	6.00e-14	260	540	114	405	Human Xylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	6.02e-14	260	540	118	409	Human Xylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]
3OTK_A	2.87e-09	264	474	84	289	Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_B Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_C Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_D Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus]
2GAK_A	1.18e-08	264	474	84	289	X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAK_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAM_A X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_C X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_D X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5QQ57|XYLT1_PANTR	3.52e-13	260	540	308	599	Xylosyltransferase 1 OS=Pan troglodytes OX=9598 GN=XYLT1 PE=2 SV=1
sp|Q86Y38|XYLT1_HUMAN	3.54e-13	260	540	322	613	Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1
sp|Q9EPI1|XYLT1_RAT	4.30e-13	260	540	187	478	Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1
sp|Q5QQ56|XYLT1_CANLF	2.43e-12	265	540	316	602	Xylosyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=XYLT1 PE=2 SV=1
sp|Q811B1|XYLT1_MOUSE	5.03e-11	260	540	316	607	Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000073

TMHMM  Annotations     

There is no transmembrane helices in TPX48310.1.