CAZyme Information: TPX47391.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX47391.1
• CAZy Family: GH79
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37943.09	7.4061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000117:26761-28167(+)

Full Sequence      

MRQWAERQAQSSAAIFPSPSSTTPRPAPADAGVGAESTLPDIPAASPSWSPASRSTTTLL
ESTTQSPTAVHSSSIVLPPVPPTHNGTGIPRIMHRSWKTIHVPTAMQKWTSTCTRLHPNW
THILWTDAMNRELIKQHYPFFLGTFDAFEMSIMRADAARVFYMHRYGGVYMDLDFECLRA
LDPLLHAPAAVLAYLSTDYKYEHNIPNAWMASSPNHKFWELAARFMVFNQHSPAVKRTSP
ETLTGPVMIYNAYHKWMTRYEHTDLDDYKVIVLDSELIYPFDWHTRSPASEQCWARAPEY
DPVACKRMLDVVAKASYAITYWSHTWEKLPSER

Enzyme Prediction     

No EC number prediction in TPX47391.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	106	186	1.5e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.26e-27	89	229	82	217	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.31e-16	112	185	10	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH56535.1|GT32	4.31e-52	89	325	104	362
UKZ71055.1|GT32	5.23e-52	88	325	96	356
BDA50134.1|GT32	6.07e-51	89	326	46	285
QLI72987.1|GT32	3.09e-50	82	325	63	344
CCA69342.1|GT32	1.21e-46	91	327	132	376

PDB Hits     

TPX47391.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.19e-29	89	262	62	232	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.35e-28	89	256	82	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	4.32e-28	83	256	51	218	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	6.15e-27	89	256	55	219	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.99e-24	89	257	64	230	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000015

TMHMM  Annotations     

There is no transmembrane helices in TPX47391.1.