CAZyme Information: TPX47136.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX47136.1
• CAZy Family: GH79
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		67939.59	5.5000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000122:5873-8732(+)

Full Sequence      

MLLRRLLAVLISSTVVTASFLPGWWMSSYDDIYDAKTGCVPHDAYRSTRSITLHIARGPA
APAGVSKNVILVNGQATALPVVGVEGETLQVTVENELDEATTVHFHGFYQQNGLNMYDGS
TFVAQCPIRPHSRFTQYIALNQSGVYWYHSHSGLQYGDGLRAPVVVLPRCQRPELKGVDS
YIVGFTEHYFNTSSFLQPTYLSGNNTIGIYSPDAGLINGVGLYNCSDPIPDNSTCVAEPQ
PWTADVVQNQTYYLRFVCMSQMAGYNVSIAGHNLTIIEADGDDTYPYTVEEVEISIGQRI
GALLTANSAIGNYQILTRMSLATVNNPYQSFNENFTAALHYVGAEPANWTNLVFQNESAI
TNRVTDRDNGKLVPINFAPPTECVTKQVFVKWGFYQTNVNTTFYPFMSYTVNNLSVATNS
SWVGTPLPLLALTKYDKEYPGKANIVEIELGDVVEIILENAGLQPHIWHLHGQSFFVTAN
GTTTAENVTAAQVVNATYIPGSALRDSVRVPVDTFVALRWKAENPGVWAFHCHIDFHLIT
GMALNFVVGKKYIQEHFELPRPWWDVCYDSSVAGILPPWSENYTISGDPGATSYLEQPGW
CGIRKPNHWKCGFA

Enzyme Prediction     

No EC number prediction in TPX47136.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	65	543	5.1e-82	0.9804469273743017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.58e-54	61	549	14	524	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	3.91e-49	69	549	44	547	L-ascorbate oxidase
215324	PLN02604	1.69e-45	61	549	37	547	oxidoreductase
225043	SufI	7.95e-45	72	549	57	449	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
274556	laccase	3.89e-40	65	548	20	519	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA70550.1|AA1_1	2.68e-66	47	570	51	555
CCA73753.1|AA1_1	1.20e-62	44	567	24	526
AIG55536.1|AA1	4.83e-60	48	555	42	542
QRV94974.1|AA1_1	7.08e-57	61	565	33	514
AIT51846.1|AA1_1|1.10.3.2	8.39e-56	53	570	29	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X1B_A	2.90e-57	53	570	29	515	Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus],3X1B_B Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus]
1GYC_A	2.50e-56	52	567	7	488	Chain A, LACCASE 2 [Trametes versicolor]
4JHU_A	2.08e-51	53	567	8	485	T2-depleted laccase from Coriolopsis caperata soaked with CuCl [Coriolopsis caperata],4JHV_A T2-depleted laccase from Coriolopsis caperata [Coriolopsis caperata]
1HFU_A	8.69e-51	52	578	8	495	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	8.86e-51	52	578	8	495	Chain A, Laccase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12718|LAC2_TRAVE	1.02e-55	52	567	27	508	Laccase-2 OS=Trametes versicolor OX=5325 GN=LCC2 PE=1 SV=1
sp|Q99046|LAC2_TRAVI	1.38e-54	52	567	27	508	Laccase-2 OS=Trametes villosa OX=47662 GN=LCC2 PE=3 SV=1
sp|Q99055|LAC4_TRAVI	1.84e-52	53	567	30	509	Laccase-4 OS=Trametes villosa OX=47662 GN=LCC4 PE=3 SV=1
sp|Q12719|LAC4_TRAVE	3.38e-51	53	567	30	509	Laccase-4 OS=Trametes versicolor OX=5325 GN=LCC4 PE=3 SV=1
sp|Q02081|LAC4_THACU	2.88e-50	44	562	18	497	Laccase-4 OS=Thanatephorus cucumeris OX=107832 GN=LCC4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001519	0.998436	CS pos: 18-19. Pr: 0.9247

TMHMM  Annotations     

Start	End
7	26