CAZyme Information: TPX38650.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX38650.1
• CAZy Family: CE4
• CAZyme Description: Chitin-binding type-1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A507CAP3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586		62983.01	7.9578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

Full Sequence      

MNLAISILITTLLASLHTAIAYRCIERYALTVTTDAQAFGATAQFDECMHFPNGMALQFQ
SGSLQDLKLPIVISSATCDGNELMQFADLSHNAHKTAYGTYDLLIPLNHSVYVKKIQLRA
QKVDATRLYLDKIFIVQCTPAFHLQKRASEGSCGPEIGSCPFGYCCSTYGYCGTTRAYCG
AGCQANHGNCTVVTIQTSPTVRSSASTANLSPSTSVTFSRSSSITRSISIKPSPFASPTP
SQITSNLPSSSPATEASSIISSRSPPPAVQNSATRYSTITAPRSTSLTRRPTGANPSPSK
TIKTPTSWDNSEAAFPTLGASCSSTCGSPQIQCIDSICQRYWTQPLWTSTTLTDKIMLEG
WNVTKYAYDAGRSVTTDPAGGSELVMRVPYPAGSRNPAHEPIGGTGFYASPLGDMTGMTH
VVMQFDVYFPAEYNFVKGGKLPGGIGGHSGCSGSATATDCYSTRHMWRTNGLGEVYLYIY
QPGQLPGFCSENNTICIPTDGISVGRGSFKLATGVWNTIKQIVTLNSFDSKGNPVPDDKK
AVIFRLTPDMHPVGIDFETFFGGSDDTWSSPTLQYSYFRRVSLSAY

Enzyme Prediction     

EC	4.2.2.26:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	384	582	4.2e-41	0.9809523809523809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395135	Chitin_bind_1	1.59e-12	152	185	1	36	Chitin recognition protein.
211311	ChtBD1	3.51e-11	152	186	1	37	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	3.87e-10	152	190	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
214593	ChtBD1	1.79e-09	153	187	2	38	Chitin binding domain.
211312	ChtBD1_GH19_hevein	4.14e-08	153	188	3	40	Hevein or Type 1 chitin binding domain subfamily co-occuring with family 19 glycosyl hydrolases or with barwin domains. This subfamily includes Hevein, a major IgE-binding allergen in natural rubber latex. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS02791.1|PL14_3	CDS02791.1|PL14_3	1.73e-53	360	586	54	288
CDS05384.1|PL14_3	CDS05384.1|PL14_3	1.38e-50	369	583	64	286
BAE81787.1|PL14|4.2.2.26	BAE81787.1|PL14|4.2.2.26	3.05e-39	363	584	39	263
UOH83040.1|PL14_3	UOH83040.1|PL14_3	4.08e-39	381	583	135	349
AFQ98373.1|PL14	AFQ98373.1|PL14	7.85e-39	346	584	19	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	5GMT_A	1.94e-29	373	583	46	270	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
3A0N_A	3A0N_A	1.54e-14	350	586	5	243	Crystal structure of D-glucuronic acid-bound alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_A Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_B Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3IM0_A Crystal structure of Chlorella virus vAL-1 soaked in 200mM D-glucuronic acid, 10% PEG-3350, and 200mM glycine-NaOH (pH 10.0) [Paramecium bursaria Chlorella virus CVK2]

Swiss-Prot Hits     

TPX38650.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002136	0.997837	CS pos: 21-22. Pr: 0.9688

TMHMM  Annotations     

There is no transmembrane helices in TPX38650.1.