CAZyme Information: TPX34119.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX34119.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		70405.76	7.4967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000510:7543-9715(+)

Full Sequence      

MTSVSSLLFSSGPIHESPKASRHSRRDPVLVVHRPLPPPHTAPQPTMNYLRRNGSLIYDG
NYVFRFVSYNAPNLHFNEDGSIPIPYEQDDTLLSIHQINGRVVRLYVLSVQSSTDYPIQR
HIVLNTTSPNTALIFNDVTMRGLDQVLALARLRQVRVILPLIDNWSYWGGVKEFAQLFNQ
PRDTFFTNSTLISAFTGLIRSLADRNNTVNGIRYGDDPVLIWETGNELQTASYDMIPASW
TLTVARFIKSVAPNALVIDGAYGLRGFSSEVLTDPAVDVVSNHYYPLAALPTSYTVALSI
LLLSIIGSAIWVAVICYMRWGCCIRRPWKSHHSDHNRPLPATPKRATTITSRKLIMPAKD
IEHDDYPSPPSPSPSPSPSPPPSPSCCQQTHGTAAAPPSYDHEPPKRRPPSLLYIGIIAS
ILVGLLIPFIVLGQQTLRDYYLHQSYAKGVKADLDTIAGRKPLLVGEFGMVPLGSVTQLL
DVVVASQALGALMWSLRSHHRDGGFYTHSEGYGYHAYHHPGMPSDSSGGFPSDDSTIPPL
IRQYASRINGQPAPFPITPPAPTLLSTMNGDLIWRGSAGASSYQIERSDGSSSNSTWSLV
ARNVADNKPGGGVLYHDDGYRNTNGDGDGDGVGVGVGVGMDSGLI

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	287	7.7e-55	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.44e-05	127	295	51	201	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEG33992.1|GH5_41	1.30e-61	44	606	27	430
QDU88840.1|GH5_41	1.97e-58	41	606	20	426
QDT72526.1|GH5_41	1.79e-56	38	606	17	427
QDS99181.1|GH5_41	2.14e-55	48	606	27	426
QDV78697.1|GH5_41	2.32e-55	48	606	29	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QP0_A	1.12e-13	128	286	71	259	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
1RH9_A	2.94e-12	134	291	78	259	Chain A, endo-beta-mannanase [Solanum lycopersicum]
3PZ9_A	2.19e-09	143	270	102	230	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
1QNO_A	2.41e-09	140	264	89	207	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
6TN6_A	3.64e-09	143	270	88	216	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0JKM9|MAN1_ORYSJ	2.22e-14	135	286	111	290	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
sp|Q5W6G0|MAN5_ORYSJ	3.66e-13	134	279	150	306	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|Q9LZV3|MAN6_ARATH	2.26e-12	134	286	119	300	Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana OX=3702 GN=MAN6 PE=2 SV=1
sp|Q4WBS1|MANF_ASPFU	1.19e-11	140	264	184	302	Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=manF PE=1 SV=2
sp|B0Y9E7|MANF_ASPFC	1.19e-11	140	264	184	302	Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=manF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000021

TMHMM  Annotations     

Start	End
294	316
410	432