CAZyme Information: TPX32483.1

Basic Information

• Species: Synchytrium endobioticum
• Lineage: Chytridiomycota; Chytridiomycetes; ; Synchytriaceae; Synchytrium; Synchytrium endobioticum
• CAZyme ID: TPX32483.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1526		170915.17	5.3166

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SendobioticumMB42	8031	N/A	0	8031

• Gene Location: location=QEAN01000568:3097-9375(-)

Full Sequence      

MEISSDAISNSVSTNNSPPIGCEELRATREFIHHDKSTAFFPFLSLLSESTIFKSNRIPT
DEAAYKSVLDLLLQHQQALLSGPMAIPLLKMSLSLHEFAPAVQAHFQFYESTVVEEIASS
NTSFNDCGNWVDWYGIQYCDSQAWMSDVSGLPHQEPRKLLPIDHIYTAVGKHGEKVPTAI
LYADLTSKDFMTWHSLLMQKADAGMITYVLRYRPPSVDRRPDTLYVSGYGVELAIKSTEY
LVTDDRKIDPGHDQIVLSADDGIKKAAAADTTDILSNAEPVIQVLNTEEISDLSVKTAQY
ILAASDPFGTLQQLSQDFPRFAHLIAAITLQPLYENLATRIPQPQEDGIVILDAEQQSSS
KLYLNGLEIDAETINVFKLLRLLKSEHKVVSSLVSLGFAPETAIELLSSIGGSETADEKM
LGQMFDTRSDAVFWWNDLENDKRYQYRFGNSIQDLLRPSFPGQMKFIRKNLVSTIYAVNL
AAPEQAKLVLESLSFIDRDIPIRMGLVPLIDASDEASSLIAEMILYTLHHKGRRDGRGFL
QSLLLELLRKSQPEELLNDLKNVWTSKYADISLETIKNDELVMKQMALIREFMSRLGLTA
KLGAVIVNGVLLDADETYTQRMVRTYFQHINYMIGQLLNLELGDNDNVYDYMMNLPHVLP
RRNQYIFTSDSSPLKMVDVLQADDLGVVDELKYLSSPYSKEVAPVSIWVVGDLTTTFGAQ
LALNAIKSLKSADGMRVSFLHNPSLNDTVATLEKAMIPTILSLQDDSISSNDIESYLSAI
VKGNKPSLSVTPKGHDETVTMKISSFVIDGLAIPSGPMMIIANGRVIGPLSEASVLTESD
FQLLVNVERKERAGSLWTKIRSSHASSKWPESRSADIMLKVASVVMASNTAITASGTYTS
DKGRVPKWTSLMKDNAHPELSFTNGVNPSEAFFRLVVTVDPASHTAQKISSIINVLKDMD
KTHVEIRLTPASSLSKTPVSRFYRYSLSSEPSFDETGNLQGSYVRFDQMPLDPLLTLGYE
VPNAWVVSAISSVHDLDNIKLAKLDAASRVKGVEAIFELKYILVEGHARDLSDNQPPRGL
QFILGTPSHPAMGDTITMANLGYLQLKAFPGVLDLRIRPGRSRDIFEMVSAADSFQSRKN
LATDALLGTEGSKIAVTSFEGVTLFPVVRRRSGMEDKDVLLPDEAEKTAATEGSFWKSIV
GSLSRDKKRPAPTEATINVFSVASGHLYERFMGIMMLSVLRHTKSPVKFWLIADFLSPSF
KDFVPLLAAEYDFDFEFVTYKWPHWLRAQTEKQRTIWGYKILFLDVLFPLSLEKVIFVDA
DQVVRTDLKELMDMDLKGRVYAYTPFCESRTEMDGFRFWKQGYWAQHLGGKPYHISALYV
IDLVRFRQLATGDRLRQSYQMLSADPNSLANLDQDLPNNMQHQIPIFSLPQEWLWCETWC
SDEELKTAKTIDLCNNPLTKEPKLDRARRILPEWEGLDNEIRRFADRIKKNVTVGDESGV
THGVASQTKELQAKDIKVEHGEKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1217	1464	3.6e-133	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1217	1464	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1217	1484	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
132996	Glyco_transf_8	1.81e-62	1217	1464	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	2.44e-52	425	666	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	1.20e-48	1065	1180	1	108	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05797.1|GT24	1.59e-315	16	1511	31	1466
QDS71787.1|GT24	5.95e-295	16	1526	40	1504
CAK39488.1|GT24	7.07e-294	16	1488	41	1459
CAS97678.1|GT24	7.07e-294	16	1488	41	1459
QGA15584.1|GT24	3.38e-293	35	1488	52	1459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	1.24e-283	17	1490	21	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	2.46e-283	17	1490	21	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	1.90e-282	17	1490	21	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.09e-245	17	1426	14	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	5.24e-216	659	1490	398	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NYU2|UGGG1_HUMAN	4.17e-267	30	1495	66	1534	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	1.11e-264	30	1489	49	1512	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.20e-264	2	1484	41	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	2.38e-264	2	1484	41	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09140|UGGG_SCHPO	3.11e-250	30	1481	41	1421	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TPX32483.1.