CAZyme Information: TPX25746.1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: TPX25746.1
• CAZy Family: GT4
• CAZyme Description: alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475		54892.84	10.5620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisWA_211	7936	N/A	121	7815

• Gene Location: location=RHJW02000001:4434450-4435994(+)

Full Sequence      

MSLSRSPSPRPDGGWSSPGLTTGTGGSGTSTPRKGYSDLQSGGGLYMKGIGAAGPGGVSW
AAAKAKSDQVRGYPSFSTRNNGFFSRQRRKISASLPRFRMNSAYGEKEKLGRGRWSPNGG
PLLSRLKTLLGNLLRRKRVQLLLLLILMFVFWLVFSQPIYEAYRRSSLGGGKKIVLIVAS
NLGGGVMEWKGAREWAIERDSLRNKRRYVKRWGYDLEIVNMVTKKRYAHEWRESWEKVDT
IRSALRKYPKAEWFWWLDLHTFIMEPSLSVENHILKNLGKKTYRNINTYNPLNITHPPSL
FYLDPLSLSVEGDGKESSINMLVPQDCSGFNLGSFMVRRSAWTDRLLDIWWDPVLYEQKH
MEWEHKEQDSLEHLYTHQPWIRPHVAFVPQRRMNSFPPGACGDGTNLGIHYQEKNRDFLV
NMAGCEWGRDCWSEMYHYRQLSNRLNRNPWEKFKDGISERWKKTFGKKKEEKKKT

Enzyme Prediction     

No EC number prediction in TPX25746.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	172	433	8e-82	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	5.38e-74	173	431	4	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS52882.1|GT34	3.15e-226	1	466	1	481
QSS70889.1|GT34	3.15e-226	1	466	1	481
QGA18768.1|GT34	3.79e-219	1	466	136	590
CAP69563.1|GT34	8.52e-215	1	455	1	444
CDP23580.1|GT34	8.52e-215	1	455	1	444

PDB Hits     

TPX25746.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	6.19e-104	155	453	103	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	4.16e-92	174	452	75	342	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	4.16e-25	199	450	125	358	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.23e-23	173	450	103	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09681|GMH2_SCHPO	3.80e-21	155	436	83	342	Probable alpha-1,2-galactosyltransferase gmh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

Start	End
141	160