CAZyme Information: TPX25716.1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: TPX25716.1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36061.27	9.5009

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisWA_211	7936	N/A	121	7815

• Gene Location: location=RHJW02000001:4367472-4368576(-)

Full Sequence      

MQFALPPRKSSNPPLYARPSPSSALRRRQLKSVAVLGFIIISVFFFISHIFSSGDSSTTT
VASGPKVVLVTVLDEQSLSDKYIQRIKQNREDYVKRHGYINFFASTSEYVSVLNNAPRSW
ASVPAVRHAMTLYPGSTYFFHLSPHSLIMDPTIPITSHVLDPKQLESLMLKDIPVVPPDS
VIKTFSHLSGKDVDLVITQDAENLCPGSFVIRQGEWAKFFLDAWFDPLYRRYNFAKAETH
ALDHIVQWHPTMLARLALVPQRILNSYSPQSSKAAASGKYREGDFLIRFKGCEAGGQRNC
EQEMEPYFQEWAKKTGNDK

Enzyme Prediction     

No EC number prediction in TPX25716.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	65	297	6.7e-72	0.975609756097561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	3.14e-69	65	296	3	236	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49429.1|GT34	6.64e-141	1	317	1	322
QSS67872.1|GT34	1.34e-140	1	317	1	322
QSS60522.1|GT34	5.42e-140	1	317	1	322
AAY62606.1|GT34	2.83e-138	1	314	1	314
BCS01218.1|GT34	4.01e-138	1	318	1	318

PDB Hits     

TPX25716.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	2.31e-34	74	318	115	357	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|O13640|YGWH_SCHPO	1.33e-33	54	310	52	309	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|P46985|MNN11_YEAST	1.85e-32	65	309	158	417	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|Q09174|GMA12_SCHPO	2.33e-30	74	318	115	357	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	7.69e-26	66	292	88	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000026

TMHMM  Annotations     

Start	End
32	51