CAZyme Information: TPX23211.1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: TPX23211.1
• CAZy Family: GH72
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A6C1LYN4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577	RHJW02000002|CGC6	63636.02	6.0957

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisWA_211	7936	N/A	121	7815

• Gene Location: location=RHJW02000002:427222-429254(+)

Full Sequence      

MASTQNEPKSYDYIVCGGGTAGCVVAGRLAEDPNITVLLVEAGQHNENLENVHMTGGWLN
NLDTEADWNIITPPMPGVNNRQVKLSRGKFLGGCSGVNGTLCVRGCKQDYDDWQLEGWSG
EEFFQYMSKAETFHPKPWFQANEGSHGSCGPLHIEPHDLAPISQRIMDSFVSKGLPYDAD
MFTTGETPHGCGHAPRTVYRGLRSTSADFVTKDCQRKNLTIKTDTIVDRILFEQDDKGAL
CAKGVVTIAADGTQQIFHADREVIVSGGAYCSPAILMRSGIGPKEELEKHGIRCEVDLPG
VGKNLMDHLIVFMFYETEKEGLTNDHLIYHGDAKEKSYALWKNHKTGFLSTFPFGAFAFA
RLEDRLADEPLWTQAKHEPGRDPMGLMPSQPNIEFFTTECYGGPKQYSKYPIDNKHAFSI
IAELFGPRSRGTVTLNSSDPRENPVVHCNYLDDPLDLLVLAEACRFANEIVMTGTGTKDI
VKGSWPPELTHHTYKTREEWVPYVKEHATTCYHAAGTCAMGKSGNPMAVLDEKLRVRGVS
GLRVADCSVMPLLHGGHTQMPAYGIGEKCADLVKEGK

Enzyme Prediction     

No EC number prediction in TPX23211.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	575	5.9e-165	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.94e-99	9	577	6	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.45e-98	9	574	4	532	choline dehydrogenase; Validated
274888	Rv0697	4.05e-63	12	573	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.11e-34	427	569	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.05e-32	78	310	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48130.1|AA3_2	0.0	1	575	1	572
QMW36070.1|AA3_2	0.0	1	575	1	572
UDD65288.1|AA3_2	0.0	1	575	1	572
BCS07163.1|AA3_2	0.0	9	575	3	567
QRD92967.1|AA3_2	0.0	1	575	1	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	8.51e-88	7	574	3	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.19e-87	7	574	3	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.67e-87	7	574	3	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3LJP_A	3.12e-65	9	577	12	530	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	4.34e-65	9	577	12	530	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.73e-78	9	574	3	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|B4EHJ2|BETA_BURCJ	5.18e-73	9	574	4	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) OX=216591 GN=betA PE=3 SV=1
sp|A0B2F7|BETA_BURCH	1.41e-72	9	574	4	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) OX=331272 GN=betA PE=3 SV=1
sp|B1K707|BETA_BURCC	1.41e-72	9	574	4	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) OX=406425 GN=betA PE=3 SV=1
sp|Q1BQE2|BETA_BURCA	1.41e-72	9	574	4	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) OX=331271 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000004

TMHMM  Annotations     

There is no transmembrane helices in TPX23211.1.