CAZyme Information: TPX22858.1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: TPX22858.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	RHJW02000003|CGC1	97618.50	5.0215

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisWA_211	7936	N/A	121	7815

• Gene Location: location=RHJW02000003:2836243-2838918(-)

Full Sequence      

MVQGAARRAIFPIDQKWEFKQANDEGGRFLPVAQFPTNIHLDLMQHGIIEDPFVGKNEDK
VQWVGEKAWVYRTTFPTPLGLNTAIKAVLAFDGLDTYATVNLNGKTILMTENMFVPERVD
VTEILEPRNGENTLEITFESAFEIGKRFQERHPEHIWGCWNGDPSRCAVRKAQYHYGWDW
GPMLMTCGPWRPIRLETFTSLIADLYCRTDVDKSLENAEVAGTVEVEGEGDEVILQLLYQ
GDTKAQKSAHIDAGVATATFLIRDPQLWYPAKYGAQPLYIVRAILRGSGIELDSVSKRIG
LRRARLVQRPLDETSGESFFFEINNVPVFCGGSNWIPGDNFVPRISPEKYREWLHLAVDG
NQAMVRVWGGGIYEEQIFYDTCDELGLLVWQDFLFACGNYPAYKSFLETVEREAIANVKR
IRHHPSIVIWAGNNEDYQYAESEKLEYNPSDQDPSSWLKSSFPARYIYEKLLVDVMSMYS
PDTYYHFGSPWGGRTSADPLEGDIHQWNVWHGTQEKYQNFDKMSGRFVSEFGMEAFPSIQ
TIDSYLPGGNDDHDRYPQSSTVDFHNKAVGHEKRMALYMVENIRYNFDPFEQYIHCTQVM
QAECLATAYRLWRRQWKGLGKEYCAGALVWQMNDCWPVTSWAIADYYLRPKHAYYAVRRE
LAPIIVGLKRPMGEASNAGPDMRKIDIWASNFTLETKEVQVVVKIFDIVTGEEIHVETLF
DSFVLEQNQSTEITQYKIPPSIGDKEGTTFHLVIAAYLFESGEQIARSINWPEPLKYVHI
QRSSELKVALSKDSCQVQLSSCIPVKGLALYSQREAVKFEDNCVDLVPNETLHIGVRGLE
KGQETEISVRFLL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	758	8.5e-92	0.723404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.85e-82	34	658	29	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	2.98e-17	684	777	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	4.87e-11	202	302	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	3.96e-10	70	437	112	452	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62028.1|GH2	0.0	10	852	6	857
QSS71278.1|GH2	0.0	10	852	6	857
QSZ37651.1|GH2	0.0	6	852	2	853
ATZ49691.1|GH2	0.0	6	852	25	876
UQC87618.1|GH2	0.0	2	852	23	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.67e-143	6	695	22	677	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2JE8_A	7.04e-122	1	852	1	836	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	7.21e-122	1	852	1	836	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2VJX_A	1.31e-121	3	852	1	834	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.69e-121	3	852	1	834	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	6	852	2	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1D911|MANBB_NEOFI	1.69e-274	11	852	7	843	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	1.80e-273	17	840	13	830	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q4WAH4|MANBB_ASPFU	6.25e-272	11	852	7	843	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	8.85e-272	11	852	7	843	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TPX22858.1.