CAZyme Information: TPX22838.1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: TPX22838.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	RHJW02000003|CGC5	49076.44	8.3713

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisWA_211	7936	N/A	121	7815

• Gene Location: location=RHJW02000003:2758429-2759837(-)

Full Sequence      

MRILWGRLRWRFLVLTLPASLFLLWTALPYDSSIRLALRFNLNALGSPFASQRLFVKPPA
FPVTISKDAGIILKSGFGTKDRISAWLESHQERSFVDILVVGDFATQPGQHYNYSGRQLN
VHDLLARMLENGSLPPGLSHPRLLKYSNLTVAIATGDTNLALELSKSFGWELDAMKFISG
LELAYKRMPLKKWYILADDDTYIVAPSLEGFLGHFDSNLCYYLGNPVGDYRGRFAHGGSS
VILSQATMRRLFENPEIVSAAHEESLSETWGDKLLATTLIKLGIYLEEGYSRFFNGEPPR
SAKLRSDRFCIAIMAFHGLSPLAMLQTGRMFRHAVKPVRWIDLLSIYQALLPDTFTQQSI
RQNWDHVGSLDESTKSINVTTAGHCGEACHADSSFCLAWTWELDTQACHMSPWVIVGDNA
PGKASGLNTPRVKKLATTC

Enzyme Prediction     

No EC number prediction in TPX22838.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.04e-04	191	251	85	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238533	APPLE_Factor_XI_like	0.003	362	410	7	54	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
394981	PAN_1	0.008	371	413	14	55	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46572.1|GT31	1.79e-172	14	439	15	445
UDD63456.1|GT31	1.79e-172	14	439	15	445
QRD93690.1|GT31	5.10e-172	14	439	15	445
QMW34518.1|GT31	5.10e-172	14	439	15	445
BAE56843.1|GT31	5.10e-172	14	439	15	445

PDB Hits     

TPX22838.1 has no PDB hit.

Swiss-Prot Hits     

TPX22838.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999976	0.000054

TMHMM  Annotations     

Start	End
12	34