CAZyme Information: TPX22338.1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: TPX22338.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		49428.52	6.5567

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisWA_211	7936	N/A	121	7815

• Gene Location: location=RHJW02000003:1041052-1042395(-)

Full Sequence      

MAIYNWFGRWRCWVFILSPIPFIILLHQLLTYHDLLQHPFIKNAPKITESGCDAVPGMED
ILVVMKTGVTEALEKVPIHLETTLSCVPHFAIFSDFEEDISGVQTYDVLRTVSKDVKRFN
PDFELYNRIKKLGRDGLRPSDLMMDDVSGPSGKPNNPGWKLDKWKFIPMINEALEVRPDA
KWFVFMEADTYIVWQNLLAWLERFDPSKPYYLGTEMLLGNILFGYGGSGFVISNSAMEKF
SQYRASRATQLEDYTAHQWAGDGILGKAMADAGIPLTKSWPMLQTARVWDLNHFAEPWCY
PVVSYHHMTPSDVEIMWRFSQQWFKNNTSSILLHQDVFTRLIQPGLSSPRDNWDNFSEEE
HNVPSEDQCKALCVDNSACLQYSHRSGKCFTSKTAKRGASTSSCKSGWIPDRIRQHAEKM
GSCEKLEWIR

Enzyme Prediction     

No EC number prediction in TPX22338.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.13e-05	178	312	209	346	hypothetical protein; Provisional
367085	Fringe	3.17e-04	178	233	83	152	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
394981	PAN_1	0.003	354	390	13	51	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD60864.1|GT31	3.90e-156	8	429	4	440
QRD90967.1|GT31	1.57e-155	45	429	50	440
BAE61153.1|GT31	2.23e-155	45	429	50	440
QMW31901.1|GT31	3.68e-152	45	425	50	436
QMW43934.1|GT31	5.21e-152	45	425	50	436

PDB Hits     

TPX22338.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NS00|C1GLT_HUMAN	6.60e-06	164	240	145	223	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000032

TMHMM  Annotations     

Start	End
13	32