CAZyme Information: THC99385.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC99385.1
• CAZy Family: GT31
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A4S3JVF0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		82120.64	5.6110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000019:34809-37238(-)

Full Sequence      

MADNQDVFIPVATGPIHPSIPSRNDHPVPKKGIVDTTGPIETNKFYCGLFLGSQSNYTFT
HPYALAWSKGGASLKSYGMAISHVESNVLAWGPTNAKIPGNPVSYYVNPIDIQPMILSAT
EFTDSTSLTTEKLLPFSANAVLRPQDGSKQRLTIPIVQGMGFVTGIYSGLQPTIQSGVHF
DKVVSAGSPRSGIYKYTATLADGTTWLIYVTPDDGKDPDLRLESSTNLRGPQGWSGTIQV
AKNPAGTSGEKLYDNSSGVYAMEGAIAGEVSRTTGTYTLAWAKAGKDAQSTPLLMFALPH
HIESFDSNTKGRVTGISLRTTTKGQATAVIGETWVMTEPDLPIDMGFAPWSVSKGSVDNL
SAGAKKVILDVAPTELQQDIDKQCDLNSMYYSGKALSKFATLVYTVDKLGGNPQLCDSAL
KALKNAFSRFINNKQQFPLVYDDVWKGVVSSASYNGGDTGADFGNTLYNDHHFHYGYFIH
AAAIIGTLDPDWLADSKDWVNMLVRDAGNPAGNDPLFPFSRGFDWYNGHSWAKGLFESFD
GKDEESTSEDAMFAYAIKMWGKTIGDASMEARGNLMLGILRRSLHSYFLMESDNKNQPEQ
FIANKVTGILFENKVDHTTYFGANLEYVQGIHMLPLLPSSPFVRRQKFVQEEWNAMFTSS
ASTPAEKVQGGWKGILYANLALVDPAASWEYFAGPNFDYGSLDGGATRTWYLAFAAGEFP
VWILLLMRMMLTASQGLVVDRPEQRNWMVDV

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	27	714	2.2e-229	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	359	712	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	2	717	50	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.67e-163	26	351	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58039.1|GH81	0.0	1	718	4	721
ABX90783.1|GH81	0.0	1	718	4	721
QRD82801.1|GH81	0.0	1	717	190	906
QMW28320.1|GH81	0.0	1	717	190	906
QMW40391.1|GH81	0.0	1	717	190	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.36e-106	2	716	3	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.44e-106	2	716	28	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	7.98e-104	2	716	3	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.88e-28	390	688	340	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.15e-24	390	705	361	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	5	725	191	909	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	4.90e-183	6	717	2	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.43e-172	18	717	412	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	6.12e-171	18	717	438	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.95e-170	26	717	66	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000026

TMHMM  Annotations     

There is no transmembrane helices in THC99385.1.