CAZyme Information: THC98332.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC98332.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683	SOSA01000047|CGC2	75793.57	6.2034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000047:2441-4613(-)

Full Sequence      

MAILRWLHGFVGLSALATLSPAQSCWRDTVCSGPKNPAFSGAWEKNVYAPASRTVKPKSV
LSLWNPSTPDKYSRSIPFTLCGNGSSVVFDFGIEVGGIITLNYSSSDEGILGLAFTEAKQ
WIGKWSDSSNGAFKGADGALFEAFSNPEDGSFVMSDKYLRGGFRYLTVYLIAEDDSTVHI
EDVSLEIGFQPTWPNLQAYQGYFHSNDELLNRIWYSGAYTLQTNTVPVNTGRQVPIRNEG
WVNNATMGPGNTIFVDGAKRDRAVWPGDMGISIPSLFVSTGDLESMKNALQVMYDTQDNS
TGAFDESGPPLSQKNSDTYHMWSMIGTYYYFLYTNDTDFLLNNWKGYQRAMNYIYGKVDE
SSGLLNVTGTRDWARWQQGYNNSEAQMILYHTLKTGVSLASWAENSEVTSNKWNTQAEDL
RRAINKHCWDNEYGAFKDNATDTSLHPQDANSMALLYGVTNKERAKKISKILTKNWTPIG
AVAPELPENISPFISSFEIQGHFEAGHPARALELIRRSWGWYLTNPNGTESTVIEGYLKN
GTFGYRYDRGYANDESYVSHAHGQSTGPTSALTNYVLGLSVTSPRGLTWRIAPQFGDLTT
VQGGFTTSLGKFQAAWEKKSDQYTLLLSVPEGTRGDLALPFLKRLERPSITIDGIHISRG
VNYTDDRAIIRVSGGGSHKVEVR

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	84	638	7.6e-94	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	3.98e-12	201	474	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	9.40e-07	588	640	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
395961	Trehalase	2.22e-04	388	474	310	398	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
226800	COG4354	2.39e-04	328	445	452	581	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
225990	COG3459	3.69e-04	389	475	763	857	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57529.1|GH78	0.0	11	682	14	685
QRD88907.1|GH78	0.0	11	682	14	685
QMW37218.1|GH78	0.0	11	682	11	673
QMW25160.1|GH78	0.0	11	682	11	673
BAU45349.1|GH78|3.2.1.174	0.0	1	682	1	679

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.82e-20	87	632	194	688	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

THC98332.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000477	0.999488	CS pos: 24-25. Pr: 0.6845

TMHMM  Annotations     

There is no transmembrane helices in THC98332.1.