CAZyme Information: THC97533.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC97533.1
• CAZy Family: GT1
• CAZyme Description: Endo-1,3-beta-glucanase eglC [Source:UniProtKB/TrEMBL;Acc:A0A4S3JPD1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		34327.45	4.9673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000071:55993-57126(-)

Full Sequence      

MRVTTLLPYVLAAIPAVAAERGQLGLALGNKNPKGDCKTTSDYEADFDAIKGVTTLVRTY
SSNDCDTAKNIIPAAKKKQFKVVLGVWSFSAPLRPDYDQSFNEDFNALKKYLPNNEDVVQ
AITVGSEVLYRGSLPAGKLKDRIIQVVDEFPKITVGTVDSWNKFADGSYNDIISDPKINY
FLANGFSYWQGQPIGNATNTYFDDMAQAKARVEQSAGGRKVRFGNGETGWPTDGGTDYEA
AKASTKFAEEYWKNAVCGILTWGVDVFYFEAFDEPWKPTSKGDNGEEKDETKWGLFTADR
KPKFNTDCPK

Enzyme Prediction     

No EC number prediction in THC97533.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	308	2.9e-36	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	7.13e-67	22	300	44	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.42e-38	24	308	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86239.1|GH17	8.69e-147	1	310	1	307
QMW46467.1|GH17	1.24e-145	1	309	1	303
QMW34414.1|GH17	1.24e-145	1	309	1	303
QRD93805.1|GH17	1.24e-145	1	309	1	303
BAE64088.1|GH17	1.24e-145	1	309	1	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.46e-30	34	277	46	272	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.80e-29	34	277	46	272	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	5.80e-114	1	308	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	4.11e-71	22	308	25	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	4.06e-64	11	308	9	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|O13990|BGL2_SCHPO	2.35e-63	18	308	36	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P43070|BGL2_CANAX	5.09e-62	11	308	9	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999709	CS pos: 19-20. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in THC97533.1.