CAZyme Information: THC97435.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC97435.1
• CAZy Family: GH93
• CAZyme Description: Dolichyl-phosphate beta-glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A4S3JPC7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		44313.95	7.0922

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000075:34049-35474(-)

Full Sequence      

MEQEAWASVCVHCTSLLVNVPAYVLLVTLVATLAGALVLTYVIVLIVAPVPRSPLPEEKR
YRTLSKEGSITESQQLPCWQDALKKRTRRMPDHTAMEEAELFMSLVVPAYNEEDRLGGML
EEAVNYLERMYGILPNYSNEDKERTARQRKAVKGPMNGPAANHWTHDIRGWEIIIVSDGS
KDNTEEVAFTFARDHQLSLHPKGYAGPWTPSTQEGVHIPPGTIRVVTLTTNRGKGGAVTH
GMRHVRGQYVVFADADGASNFEDLGKLVSACEEIEDSEGRGVARSKLRNFLMHSFHLILW
LMTPSKTATIKDTQCGFKLFSRSSLPYIIPYMHSEGWIFDVEMLMLAEFAGISVAEVPVG
WREVKGSKLNVLRDSIGMAWGLAVLRAAWSLGVYRRT

Enzyme Prediction     

No EC number prediction in THC97435.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	104	275	1.1e-21	0.6294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133031	DPG_synthase	2.47e-81	105	368	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
240336	PTZ00260	4.39e-78	98	395	67	322	dolichyl-phosphate beta-glucosyltransferase; Provisional
133022	DPM_DPG-synthase_like	2.29e-44	105	347	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	1.26e-20	104	325	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133062	DPM1_like	4.84e-18	105	382	1	224	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47880.1|GT2	7.26e-223	1	397	1	418
QMW44186.1|GT2	9.23e-223	1	396	1	414
BAE62406.1|GT2	9.23e-223	1	396	1	414
QMW32160.1|GT2	5.33e-222	1	396	1	414
QRD83590.1|GT2	5.33e-222	1	396	1	414

PDB Hits     

THC97435.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40350|ALG5_YEAST	3.90e-64	32	395	17	329	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|O60061|ALG5_SCHPO	3.69e-61	103	396	64	315	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|Q9VLQ1|ALG5_DROME	9.17e-46	97	395	62	317	Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=wol PE=1 SV=1
sp|Q54J42|ALG5_DICDI	3.62e-45	101	395	74	324	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
sp|Q9Y673|ALG5_HUMAN	9.21e-45	103	395	67	316	Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000001

TMHMM  Annotations     

Start	End
5	27
29	51