CAZyme Information: THC96232.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC96232.1
• CAZy Family: GT8
• CAZyme Description: LysM domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3JL69]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		38707.91	9.4370

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000123:45108-46178(+)

Full Sequence      

MAGTSRAMTLLVTILAYLALIPSVAGMDFVSRKGWNARAPKEAYTPITNPKGVKVHYLGT
MFTGRKHSECAAYMRSVQDEHMDDSPENYFDIAYSLAVCEHGYVYDGRGKGHRSGANGNQ
QLNNDHYAVLAFLAKYGVNKPTDDQIMGIQDAIAYLRRAGAGNEIKGHKDGYNTECPGKP
LYKLVTDGSLEPGKLWDGGSHVVKKGEDLDGISKKYNVPKRHIITANGLKKPYDLKTGQK
LTIPARGVPLGKNASANGESEGGSGDDKKMQPFPGAEWFKSKPKSAVVTAMGKRLVEEDC
NRYSKDGPGAQWNDEHVASYKCWQKKLGFTGAAADGLPGKATWEVLKVPHTEAIGK

Enzyme Prediction     

No EC number prediction in THC96232.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411663	PG_bind_siph	3.44e-32	273	348	1	76	peptidoglycan-binding domain. This domain occurs shows apparent homology to known or putative peptidoglycan-binding domains in families such as PF01471. The domain occurs once, or twice, at the C-terminus of proteins such as cell wall amidases. In particular, member proteins can be found among putative lysins of phage of Streptomyces from the Siphoviridae family, such as phiBT1.
133475	PGRP	3.25e-15	49	178	1	124	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
128941	PGRP	4.05e-13	30	155	4	123	Animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme. The bacteriophage molecule, but not its moth homologue, has been shown to have N-acetylmuramoyl-L-alanine amidase activity. One member of this family, Tag7, is a cytokine.
212030	LysM	4.33e-10	200	243	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
214760	Ami_2	5.20e-09	49	177	2	126	Ami_2 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40853.1|CBM50	3.00e-131	15	250	21	256
QRD83316.1|CBM50	3.00e-131	15	250	21	256
QMW28778.1|CBM50	3.00e-131	15	250	21	256
UDD56843.1|CBM50	3.00e-131	15	250	21	256
QKW06915.1|CBM50	1.56e-65	27	345	1	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F5I_A	2.21e-06	89	191	57	161	Chain A, amidase [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O88593|PGRP1_MOUSE	1.80e-06	16	185	6	174	Peptidoglycan recognition protein 1 OS=Mus musculus OX=10090 GN=Pglyrp1 PE=1 SV=1
sp|B5T255|PGRP1_BOSIN	9.06e-06	18	185	13	181	Peptidoglycan recognition protein 1 OS=Bos indicus OX=9915 GN=PGLYRP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999695	CS pos: 26-27. Pr: 0.9746

TMHMM  Annotations     

Start	End
7	29