CAZyme Information: THC95780.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC95780.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1454	SOSA01000142|CGC1	163042.08	4.8786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000142:41329-46015(+)

Full Sequence      

MATLCTTCCRTIFFKLLESAAEENSTSYFPLLDRIADGAFDDAVTDKEIYDRFLHVVEED
GHLKTPESLSSFKLSLAIRSASPRITAHYQYYNASVQHSLMAAQDAACPVWVHSDGKQYC
SSTMERAQQEVSGGMDARELPFDRVLGDTSLPPAILYADVASPMFKDFHQTLSALAKEGQ
VSYRVRYRPPQRWSPRPLFVSGYGVELALKRTDYIVIDDRAAEQRESDNAGPSTYSDAPD
DLRPLSSSEVARLGVNAVSYVLDRDDPLDALVKLSQDFPKYSSRVAAHNVTMELLHDIRS
SRLQMLPSGMNVMWINGVQIDSRQMDAFSLLDLLRRERKLIEKFRDIGVSAQEAVNLLSH
QFIGEALAQDAPQRYNYLDDIEGGRVLIWINDLEKDARYASWPSDLEAFIHRTFPGQLPP
VRRNANNIVVPVDLARSEDVGFVVRNIQGFVIKGIPARFAIVPVASTPGSSAQLKIAHYL
QETFGLASLMHYLEESSSQQKVASPDKGCFEAATKERKIRPEKQILSFEEVLKSEDLEDL
VSKTLSYQNRLGITGDASQSFVNGAQVIRKDSWMQEVSVRVSKDLQVIQQGIVGGEIEDG
TSLSGLFLSQAFDRRSLWAIPEDPKDIRVVDLVKVSDSQKETLGETPSIVSMKDDALDSA
YLIVVGDFDSEQGHQLLTATLEHREKHEEVEVLFIHNPGEHTSKMDASIKLYRSLKGGKQ
VDAAQVLADIKSSDYSAPSAGDAEEISKFWADKRPLIQEFGLPHGANGLVINGRTVGPID
ADVTSGDLDQLLAYEQTKRIGPVTRACKDLGFGSNLSGALAFAKLTSLTTLSTISDVPED
IFESTSDIRVNIFDKWNDSRSVITVSNSEDPAITIVASIDPSSETAQKWLPILKVLSRLA
SVRLRLFLNPREEIKELPTKRFYRYVLDSEPSFNDDGSISRHTASFSGVPVEALLTLGMD
VPSSWLVAPKDSVHDLDNIMLSSLNSGSDVEAVYALEHIMIEGHSRDLTTKSPPRGVQLD
LGTDNNPSFADTIIMANLGYFQFKTQPGLWKINLKPGRSERIFNLESVGGLGYSPQPGDE
NNEVALLSFQGKTLFPRLSRKKGYEMEDVLETSSKSGTAMDYVSKGLNFASGVLSSVGVG
SKGMSEKQADINIFSVASGHLYERMLNIMMVSVMKNTKHSVKFWFIEQFLSPSFKSFLPH
LADEYGFSYEMVTYKWPHWLRTQREKQREIWGYKILFLDVLFPLSLEKVIFVDADQIVRT
DMYDLVTLDLEDAPYGFTPMCDSREEIEGFRFWKQGYWKKFLRGKPYHISALYVVDLSRF
RALAAGDRLRGQYQMLSADPGSLSNLDQDLPNHMQHHIPIKSLPQEWLWCETWCSDESLT
QARTIDLCNNPQTKEPKLDRARRQVPEWTEYDDEIAALSKRVALGHQQKEEEMQPNLVDE
EDDEGSPEWDKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1151	1398	1.1e-133	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1151	1418	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.82e-180	1151	1398	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	5.09e-82	375	616	1	245	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	9.20e-63	1002	1111	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408199	Thioredoxin_12	6.84e-60	16	194	8	183	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD64319.1|GT24	0.0	15	1454	47	1487
QRD91624.1|GT24	0.0	15	1454	47	1487
QMW47293.1|GT24	0.0	15	1454	47	1487
QMW35231.1|GT24	0.0	15	1454	47	1487
BAE65008.1|GT24|2.4.1.-	0.0	15	1454	47	1487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	15	1422	27	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	15	1422	27	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	15	1117	22	1130	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	15	1422	27	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	15	1422	27	1217	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	5.58e-277	16	1436	39	1442	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	7.42e-231	12	1422	43	1511	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	5.34e-226	18	1418	66	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	1.61e-225	18	1421	66	1526	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	4.44e-223	18	1418	66	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in THC95780.1.