CAZyme Information: THC95009.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC95009.1
• CAZy Family: GH37
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3JHS5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782		88538.72	8.1298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000178:6935-9543(+)

Full Sequence      

MRPPSFHHIDVLTRSTGAALLCSLWTACLGSRKSELCSEILAWVILPTISGMARRLKTNK
IRTRSPLSEPDLQPQSGKSLWIVALGIATLGVYQAENGLVGVLPVLTPLLLIAERYLGSE
FGGSAGSDPQYSTPLVDTVWGTAVAASFLMITLADWGFQGYLLSAIPVAALLGIYVTLMH
RRNTRCVPLLDSEAAICPLALRVVSLLVIVFGAETVAFGFPRSQPIASIFMLGSVKASAW
YFFIDIVIYMLPGQAKSRSALWVLSVVPLIPYLVDTLRVAQSPTISGQHPIEALIDNARR
DFDTLLQKQSQDYTVAHNEYRRRYGIEPPAGFEAWFEFAKLHQSPIIDEFDNIYEAISPF
WHLNGQDIRDIMDDIQSMRTSHSEVWFCTFSGQQAKTHCSHPGRTFDRHIQSSFDHLMSS
LAGVLPDVKFLINHLDEPRVLMPLPRGPESLRSKRFNLTDLSRRSVWDTLTKYCSSREMM
ATHTAKKPTLPFVTDPVLAIDLCQHPEYSAMHGLTISPTSFYLFEGAVPVLSTGSLSTMG
DILYPSPAYNEDEFKYTVDTPDIDWNKKQNNLYWAGSTTGGFAVDEKWQYFHRQRFVQLA
QNLQRLQYSYLQENAGIISPAISSSFINGRFFNVAFTRIFQCGRRSCRDQHAYFKIKSWA
DKDQPLRSRLVFDIDGNGISGRYYKLLASKSVPLKQTLLREWHDERLRPWVHYVPVSLSM
EELPEIVRYLTSTKTGQRRAQEIAEQGRDWFAKAFRDVDLTIYMYRLMLELARLQDPNRL
VT

Enzyme Prediction     

No EC number prediction in THC95009.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	506	775	2.3e-68	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.57e-12	637	775	100	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	7.75e-08	632	775	168	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91004.1|GT90	1.58e-257	1	782	1	830
UKZ50390.1|GT90	5.21e-252	17	779	17	825
UKZ71122.1|GT90	2.38e-237	1	779	1	832
UKZ95796.1|GT90	4.22e-236	1	779	4	835
CEI63699.1|GT90	4.59e-232	8	779	6	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	9.28e-06	525	778	114	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.69e-37	289	779	152	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999800	0.000209

TMHMM  Annotations     

Start	End
156	178
199	221