CAZyme Information: THC94833.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC94833.1
• CAZy Family: PL7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		82234.08	3.8000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000187:46218-49165(+)

Full Sequence      

MAVIRIGLFSFLGILLSCGSGINAQAFLAEPDGTRLTLGYPDSLSSACQVTFNTSTQCNS
ALGAIAFDALFPSSEQLAVICTDDCLGSLQNFRSQQAQSCESESYAVDGQLVPATYNVDQ
LLFTYSYTCLQDPPTKDYCAPLVDQWSEEGPTSEQSCSDCMLRTFQVELNSPFGYDDEFA
DYYRSLTSSCGVLDYPITSPPPYTVTRTPTPTSSHTSSPTPSCASYYTVREGDDCLSVSK
AQRVSAAMLRYENGLTADCTNWPDANETCYGISQAHNTTFTVTQLISWNPDINRDCSNLE
AIIGTQLCISAPGDTAGPEITTIPAMTTAVPTPAPSNVANGTDLQCAKYYEVAPGDTCAS
LTVMMGISLTDFYFLNPEVKKANCTNLQPGSSYCVQAVGDIATYTGYGGKTDPFTTDTAW
TFPTYTTTKTPQTTSLPLAPGTLTNCSAYAEYLTSPRNTTTINSCYVVASFFDEDVENFV
SWNPSLSYDPGSPGNCQLQPGYQYCARVTGYTTTSTPTPTSAVTSTTSTQSPTSTGANGA
PTPLPIQPGMTSNCGKFYLVQLDDGCEAIATAHGISLADFYAWNAALNGDCSGLFPLYEV
CVGLLSSTTTSTTTSSTPTATGGVPTPTPTQVGMVSDCTEFYLVKSGDGCYDIAATDRIA
LSDLYSWNPALNGDCSGLWPDYYICVGRGESISASSVIPTTTTTTTAAANVTPTPTQAGM
VSGCKSFYLVQSGDGCYDIAASHGITLDQFYSYNPSVGGDCGGLWPTYYVCVGVEA

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	2.02e-10	727	770	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	5.21e-08	641	684	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
180536	PRK06347	5.24e-07	549	754	325	508	1,4-beta-N-acetylmuramoylhydrolase.
180536	PRK06347	3.78e-06	551	754	401	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	1.19e-05	556	591	1	36	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY65640.1|CBM50	5.25e-266	20	773	17	779
QPG98790.1|CBM50	3.69e-162	22	604	21	554
UKZ60082.1|CBM50	1.80e-113	41	505	36	527
QKX60067.1|CBM50	2.57e-111	407	774	12	288
BCR84638.1|CBM50	1.08e-102	43	774	34	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BUM_A	5.35e-06	638	686	2	48	Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense],5BUM_B Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	2.63e-53	376	773	98	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	2.21e-41	292	604	207	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B4P8|LYSM2_ARTBC	6.73e-15	638	775	29	182	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	1.09e-14	625	774	256	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	1.28e-13	716	774	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000489	0.999454	CS pos: 24-25. Pr: 0.9631

TMHMM  Annotations     

Start	End
7	29