CAZyme Information: THC94729.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC94729.1
• CAZy Family: GH3
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3JH31]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
882		98072.34	4.8072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000191:17470-20441(+)

Full Sequence      

MLLLANILHWFFLFLAVYGACIPLRGPLENGNSTINPEHNDLHVFSKRASRVNLRILPLG
ASITFGQNSATGNGYRKPLRDELRYQGWEVNMVGTKTQGTMVDNNVEAHGGDIIDQVKSA
AQDSLPYRPNVVLINAGTNDCARNIDIDNAGGRMRSLIESVVNTEDMEKTLIVLSTLIPS
QVSSTEANRPSVNRQYRELVSTMRGEGISIVLADMDPEAPSPGHGWLHYPEDYTTGDNPP
DDTHPNDKGYSKMAYIWSQAIDEAADEELIAEPGPMAPVPCEKDYGDGVDAGGLTQRGSG
LDDGIYYHDSQEKGTLLSLDSQGDDGDHFFFARLFRRERDDLLRWNKNDDAVVYHTWKNT
GNEKGMFKRIGDVSVADNCKPAGVNFIDINADGLDDFVCIAPDGTAFASINKGDGTDSSP
PSFHYLGKIKNPEGYPRDNVRLGDVDGDGRADYCVVQNNGDTYCWRNGWIKDVPEYWQPL
GKQFTGNNMDIEGLRFEDINGDITTWTNSRSCIKGKDGDGLNIVWRQGYHKGKTTGPTHD
GMGSAHSGLRGRIHFARIYGEAQDFGLLGRQDYVFLEKAANRVNLRVWKNIGSGGTKIKG
HSNGMMDYVWILSKGKMTLYPNKGLNTVSDNGESFWGPSSTIFDPNAMSIARDVDRRDLH
LMDWDGDGACDIVWTDPDNDNRVHLWRNRIKETGSFDWEYQANPAPDLYCPEQRGQGIFD
TSVRFADITGNGRDDYLCVERDGRTWGWVHDDNHWEYIDQFKFSEGKDRANLHWADVDGD
GRADMIHTDKFTGDGSVWYNRGRRDVGGSRFEWQSVGAKYKGAVAGSCIYFPELSGNGRA
DMHSITHALDNTARTLFNRCTPPDSTGDDGPITDPNLPEPSG

Enzyme Prediction     

No EC number prediction in THC94729.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	54	261	3.8e-57	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	4.68e-39	54	261	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.30e-13	59	250	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.88e-11	56	254	1	181	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	9.69e-10	56	254	1	221	GDSL-like Lipase/Acylhydrolase.
239945	SGNH_hydrolase_like_4	1.46e-08	55	261	2	183	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58486.1|CE0	0.0	52	878	59	917
ABA65775.1|CE0	0.0	19	878	23	913
AAD34550.1|CE0	0.0	19	878	23	913
EAA66327.1|CE0	0.0	15	880	19	866
UPK91538.1|CE0	1.59e-273	41	877	51	901

PDB Hits     

THC94729.1 has no PDB hit.

Swiss-Prot Hits     

THC94729.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002670	0.997303	CS pos: 19-20. Pr: 0.9528

TMHMM  Annotations     

Start	End
2	24