CAZyme Information: THC93473.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC93473.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		66674.83	5.0473

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000263:4744-6724(+)

Full Sequence      

MTRLQDFTKHHFDYLIIGGGTAGLVVARRLSDRSDVSVGVVEAGPTALDEPAINTPGLYG
ETLGGRFDWKFETEAQSGLEGRTIPCPRGRVLGGTSALNYMAWTRGNREDYDAWAELGNE
GWGWDDLLPFFQRSETFHVPDASHQEQYRSYYQAEAHGTTGPVHTTHIREYGPSHRFWHD
TLHRFGVEVSADSLAGSNVGAWNMVCSIDPEKQARSYSANAYYLPVKERPNLALLTEAIV
TEVLMKDTGETWTASGVRVRCDGEMSDIVVSREVIVCAGSIQSPQILELSGIGNCEVLSA
AGIPVKIHNPNVGENLQDHLMTVSIFEVQPSLTTRDDVLSDTELYEAATQEYEASRTGPW
TVLPCSIAYCPLSTFITPDQLADLHRQAKEIAQETGRHSDEILARRFKANTSLGHIEFLF
DLGNWSPFFASEPGKKYGTMLQMLQYPFSRGSVHIPPQSSDFRTTVAEDPLIDPRIYLGP
GEIDRNVMSLAQEFGTRICQTEPLCSIIRFRSHPATEEHDKFVVQNTITDWHPIGTCGMG
GKAGDRQGVVDHRLQVYGTRGLRVVDASIMPLQISAHIQATVYAIAEKAAVMILEDRAES
AGL

Enzyme Prediction     

No EC number prediction in THC93473.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	596	8.5e-177	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.94e-102	9	600	5	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.11e-96	8	594	2	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.00e-39	81	320	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.04e-27	447	589	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.69e-16	10	603	54	587	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87580.1|AA3_2	8.41e-295	1	596	1	607
QMW26329.1|AA3_2	8.41e-295	1	596	1	607
UCK58874.1|AA3_2	9.22e-292	1	596	1	607
QMW38412.1|AA3_2	5.49e-270	1	596	1	581
QVM12647.1|AA3_2	4.27e-217	4	596	8	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.11e-72	12	596	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	4.22e-66	12	597	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.25e-65	12	597	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.11e-62	11	596	5	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	6.10e-59	12	596	41	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	4.22e-99	2	596	4	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	2.74e-96	3	596	5	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.74e-96	3	596	5	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.75e-79	6	594	41	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.75e-79	6	594	41	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999772	0.000259

TMHMM  Annotations     

There is no transmembrane helices in THC93473.1.