CAZyme Information: THC93194.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC93194.1
• CAZy Family: GH18
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4V3UP01]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	SOSA01000280|CGC1	50420.92	8.2349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000280:11793-13211(+)

Full Sequence      

MRWAQGQTPWFRFLATGAVLSLALIAFLSLNGHYSTNAAKYVLKSSDKQASLDPWPSCSN
NTNWEFDVQRDGNDHGLSEGQCRSAFPKLFVELDKPAEFRKKNPITLKDLNDMTVDDGMV
RGMIVRGELYIVDFGAMPATFTRGKATLNSLHRALASFPGRRHLPNIEFVLTTEDYSTGE
GPMWSYSKRDEDQHVWLMPDFGYWSWPEVRIGSYRDIRQRIAAVDDGEQTQDGHNVAGLR
FQDKKKQLVWRGSVATNPKLRGRLLKAAQGKSWASIRVIDWDNENDIRYNLLPMEEHCRY
MFLAHVEGRSFSGRGKYLLNCRSVVVSHKLEWREAHHAALIASGPEANYVEVERDFSDLE
RKMEFFIDNPEAAERIANNAVRTFRDRYLTPAAESCYWRHLIRQYASSCDFEPILYSSQK
DGKKRPRGTPFETWILTGS

Enzyme Prediction     

No EC number prediction in THC93194.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	165	407	2.7e-32	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	2.93e-28	121	413	40	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	4.58e-23	164	406	2	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD61446.1|GT0	8.52e-254	1	436	1	436
QMW41857.1|GT0	2.03e-248	1	436	1	458
QMW29784.1|GT0	5.80e-248	1	436	1	458
BCS13796.1|GT0	9.48e-238	1	438	1	441
BCS02108.1|GT0	9.48e-238	1	438	1	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.69e-12	164	412	128	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	3.63e-13	159	412	133	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	5.02e-12	164	412	138	392	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	9.00e-12	164	412	140	394	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.75e-11	159	412	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	8.44e-10	164	421	138	393	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000019

TMHMM  Annotations     

Start	End
13	35