CAZyme Information: THC92909.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC92909.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	SOSA01000300|CGC1	39517.46	4.7899

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000300:628-2107(+)

Full Sequence      

MDPTTTSTLPSDFLWGFATASYQIEGAVEEDGRGPSIWDTFCKIPGKIAGGVTGDVACDS
YHRTHEDIALLKECALLGLGLSLSYRDLPDELEKRYGGLPNKDEFVADFAHYARIPPKAF
GPKVKHWITFNESWCSSVLGYNFKATDGGEIGITLNGDWAEPWDPENPTDVEACDRKIEF
AISWFAEPIYHGKYPDSMVKQLGDRLPKWTPEDIALVHRSNDFYGMNHYCANFIKAKTGE
PDPNDTAGNLEILLQNKNGAFIGPETQSPWLRPSAIGFRKLLKWLSDRYSHPKIYVTENG
TSLKGENDLPLGQLLKDEFRTKYFRDYIGAMADAYTLDGVNVRAYMGWSLME

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	147	351	1e-44	0.40792540792540793

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	6.46e-101	8	351	4	409	Glycosyl hydrolase family 1.
274539	BGL	2.36e-95	10	351	1	392	beta-galactosidase.
225343	BglB	1.50e-66	6	351	1	411	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	6.02e-49	2	352	21	441	beta-glucosidase
215455	PLN02849	1.72e-47	7	352	28	441	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57671.1|GH1|3.2.1.21	4.61e-226	1	352	1	438
QRD82378.1|GH1	6.73e-225	1	352	1	438
QMW27934.1|GH1	6.73e-225	1	352	1	438
UDD55888.1|GH1	6.73e-225	1	352	1	438
QMW40005.1|GH1	9.55e-225	1	352	1	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	4.55e-168	9	352	26	454	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	1.67e-145	9	352	3	421	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.79e-142	9	352	3	421	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	3.33e-142	9	352	22	440	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	6.40e-142	9	352	9	428	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	9.05e-103	9	352	11	434	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.76e-97	9	352	6	419	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	7.58e-74	7	352	20	473	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	3.47e-73	7	352	19	441	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q339X2|BGL34_ORYSJ	3.40e-71	5	352	34	469	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in THC92909.1.