CAZyme Information: THC92816.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC92816.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	SOSA01000307|CGC1	94514.82	6.1223

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000307:10284-13071(+)

Full Sequence      

MQSTQLRKKVGQLFAVGFQGLTPSTEIKTLIHEHGLGGIVLFKRNIQDAAQLQALTQALQ
EEAKSAGHEHPLFIGIDQENGLVTRISPPIATQLPGAMALGATYDPNNAYQAGEATGDIL
SLLGINMNYAPVCDINSEPLNPVIGVRSFGDDPGFVGRFAAAFAQGLRTRKVVPTVKHFP
GHGDTAVDSHYGLPVIQKTRAQLEQCELRPFRRAVAEGIEAVMTAHIALPSIGDSKLPAT
LSVDALNILRKDMQYDGMVITDCLEMDGIRTTYGTEQGAVLALEAGSDSIMICHTYDVQV
ASINQIVQAVESGRIPTTRLEEAYRRVTKVKQEFLSWDTVLQSPSLDGLASLNAKAASLT
DQVYLRSATIVREKRGVLSLLSQESSTVVFLFPGDKTPAGGAVDGEGIGQNRSYDATEYL
ETLKDLGRCPNATEIRYGEAGLSSEQWTQIGAADVVVFTSINARESPWQRALGLELAHRA
RNMISIAACSPYDFLDDASIETYVAMYEPTIEAFAGAVKRMSGWGAQRGQLPVGPTKSTP
SWIKVEPLYAEMDFDALLTLWEKALPTYPLLGRSRKGLLTALTTSNAHHFVVGHGSKMIG
FCLLYIAEQQDVTCGYLTALAVDPEKQGLGVGSALIAECRSWLAKNCKKFRLELGSSFPR
FWPGIPTDLPSSVQDFFIHRGFRLNPPVPRSVDLYQDITNFHAPEKYLARAQEGGYTFSP
LKSEHFLKGLVGQTRNFSHNLAWVQKYMDLDPTIYPSCIMVAWDSEGNQVGWTLMLDPSC
DILQNNWIFPPTCGPKTGLIGCVGVDKDHRKNGIGLALVSHAIENLKQRGVEGIFVDWVS
LDGWYEKLGFQVWRSYRTGELIL

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	291	9.3e-61	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.14e-89	4	409	1	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.37e-84	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	9.36e-52	37	344	27	320	beta-hexosaminidase; Provisional
185053	PRK15098	5.75e-14	1	331	42	353	beta-glucosidase BglX.
173926	NAT_SF	5.92e-09	589	653	1	65	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40223.1|GH3	0.0	1	863	1	865
QMW28153.1|GH3	0.0	1	863	1	865
BCR85716.1|GH3	0.0	1	859	1	852
BCR93582.1|GH3	0.0	1	861	1	857
BCS06215.1|GH3	0.0	1	861	1	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.00e-149	6	860	9	857	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.57e-96	6	532	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.29e-61	6	331	44	393	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.85e-61	6	331	18	367	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	6.91e-61	6	331	48	397	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	6.62e-61	6	331	44	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.56e-55	22	331	50	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q87BR5|NAGZ_XYLFT	4.98e-40	13	341	1	315	Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=nagZ PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	4.98e-40	13	341	1	315	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1
sp|A9M1Z4|NAGZ_NEIM0	2.29e-39	26	297	23	293	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in THC92816.1.