CAZyme Information: THC92783.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC92783.1
• CAZy Family: GH16
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3JC82]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	SOSA01000309|CGC1	27902.07	5.2626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000309:27280-28287(-)

Full Sequence      

MSTKTLEIIGDSLSIGQYATYEGLSSWAYYLGSGLKDFDYSISAYSGICLHDRECWGNPR
GQTYQWHHTCDSSPRAREIYGSNPPKWDFRAHAAADLVIINLGANDDLNGVLREEFERSY
IEHINEVHRIWPQAQIILMACLELSRGSVPSGTTYVQKPQLVQEIQNVYQYFQDLGHDYV
HYFDTTGILQQNDIALESHLTDFGNVKIASHLMQWIKGRFGFGMETKGGEILHGTRYWNT
ESDY

Enzyme Prediction     

No EC number prediction in THC92783.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	6	216	1.3e-22	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	7.45e-37	6	217	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	1.93e-11	8	214	3	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	6.33e-11	8	204	1	166	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238874	FeeA_FeeB_like	0.007	93	146	66	119	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17295.1|CE0	1.19e-91	4	244	162	400
EAA62480.1|CE0	3.46e-90	12	244	77	307
CBF82105.1|CE0	3.46e-90	12	244	77	307
BCR99212.1|CE0	6.45e-82	3	244	23	262
CAK41944.1|CE0	5.20e-81	4	244	137	375

PDB Hits     

THC92783.1 has no PDB hit.

Swiss-Prot Hits     

THC92783.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999757	0.000263

TMHMM  Annotations     

There is no transmembrane helices in THC92783.1.