CAZyme Information: THC91946.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC91946.1
• CAZy Family: GH135
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43864.39	6.3325

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000371:9764-11024(-)

Full Sequence      

MWYSLPQLPDKFPDNVPGTDPNAGAYVFSDISAWTSGFFPGSLYALLERSVRFPHQFQAG
GISPVNVHERLLHMSRQWSDPLYQQAHRTNTHDMGFLMLPALRKDWELTGNSKSLHAIVT
AAHSLSARYNSRVRALRSWNSLVNKRHNITDQESNFLVIVDSMCNLDLLFYAGYHTRNQT
LVNIATTHAHTVLHNIVRDDFSTFHCCNINPENGDIKFQETVQGYKDWSTWSRGQAWAIL
GYAQTYQWTRDPIFLQTAKGLADYFILRLKESLQPCPFVPPWDFDAPTVGDSLPPRDTSA
GLVAANGLLLLHQILREDSPYLEHALQIVTETVDLSMAPDSWETILMNATINNNEYASTR
SSNTGLVYADYYFLEFGNQFLRLGLL

Enzyme Prediction     

No EC number prediction in THC91946.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	29	375	7.6e-94	0.9726443768996961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	0.004	90	247	73	206	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT05078.1|GH88	3.67e-144	7	385	78	471
UKZ61432.1|GH88	7.37e-144	7	385	78	471
QKX60666.1|GH88	3.89e-142	10	385	81	475
UKZ57213.1|GH88	4.83e-142	7	385	78	471
UNI13371.1|GH88	1.24e-121	9	385	76	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	6.53e-39	17	375	52	383	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.13e-35	10	375	44	384	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.15e-35	10	375	45	385	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	5.87e-35	10	375	45	385	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	5.87e-35	10	375	45	385	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	2.13e-43	34	375	77	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	2.16e-36	10	375	43	383	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	5.91e-35	10	375	45	385	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.07e-33	11	375	19	359	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.57e-33	10	375	46	386	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in THC91946.1.