CAZyme Information: THC91393.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC91393.1
• CAZy Family: GH128
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3J8L1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		60751.00	4.5481

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000419:8032-9789(-)

Full Sequence      

MPTRSFLWSIRSLAVFSIVSPSIADRSAKSSGSYQLHESWQGEKFLDYFNFFDGADPTHG
FVTYLNQSTAEGSGLIDVTSSGSFYMGVDYKKTLVPEGPGRESVRIESKQYYDEGLYIVD
LAHMPGSACGTWPAFWSVGPDWPHDGEIDIIEGVNKHEANEIVLHTSGSCNVGGGHEMHG
DMTSSECGEASGTVGCVVKGTQGSSGDPFNKNGGGVYAMEWTADFLKIWYFPRDSIPESI
TDGEPDPSAFGTPMAHLQGSCDFHKRFKSQKFILDTTFCGDWAGGVYGDSGCPVSDPSKP
IQSCVKYVAENPDAFKEAYWEINSIKIYQIGDNSNGPAQSASTHVDSATVIQPTRSSSIS
IANPKSETEATHAPSSPSAVEVTAAPASTKKTVQFSSAAPSDGGDNSETISKSTLYLTRT
TTICPLTLQNAYTATAVHGGQTGAAESSTGVPSVIVSEPAPEGSTIVLPSVNTIIPTGPT
EPVAQPSQPSRAAGSSTDKPPVPAPSFTSSSRFIPAPAPAPTFTAPGDSPAPGGDSGSTG
SGDSASSSGVPSATTPVVPLFTAGASRLSLGASGLVGAAVIAFLA

Enzyme Prediction     

EC	3.2.1.39:3	3.2.1.-:1	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	74	308	8.3e-85	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	8.45e-153	33	329	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	5.93e-15	124	290	88	221	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	4.00e-07	125	309	101	256	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
236090	PRK07764	5.53e-04	369	559	598	778	DNA polymerase III subunits gamma and tau; Validated
223021	PHA03247	6.09e-04	433	576	2717	2856	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58669.1|GH16_1	2.26e-192	1	453	1	469
QRD85212.1|GH16_1	1.29e-191	1	453	1	469
QMW28954.1|GH16_1	1.29e-191	1	453	1	469
QMW41029.1|GH16_1	1.29e-191	1	453	1	469
UDD59186.1|GH16_1	1.29e-191	1	453	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	5.75e-119	33	328	2	297	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	1.74e-86	34	328	2	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	1.80e-86	34	328	3	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	1.32e-85	34	328	1	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	1.41e-85	34	328	3	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UIE6|EGLX_ASPOR	4.01e-193	1	453	1	469	Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000083 PE=3 SV=1
sp|B8N7S7|EGLX_ASPFN	2.28e-192	1	453	1	469	Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_105200 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	1.91e-189	13	585	8	639	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|Q5BAP5|EGLX_EMENI	2.50e-173	3	331	2	326	Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=3 SV=1
sp|A1DHY9|EGLX_NEOFI	2.54e-171	1	354	1	349	Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_089530 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.086440	0.913527	CS pos: 24-25. Pr: 0.8751

TMHMM  Annotations     

There is no transmembrane helices in THC91393.1.