CAZyme Information: THC90792.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC90792.1
• CAZy Family: CE4
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3J7K5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		35761.90	7.0421

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000481:23415-24380(+)

Full Sequence      

MHSFITSLCLFLGSAEAAKGALHHHHNPRRDGGEHSSVLPKLSIPPSILDSYQLTWHEEF
KHRPGHYLPSSENWIFDVGTSYPGGAPNWGTHEVETYTTSPANIRVTRDDTLTITPRVSS
NRTWTSSRIETQRTDFAATPGGRLYIEGRLKTGSAPTYKQQGIWPAFWALGVDFRSNYTA
WPAASEWDLMEVVNGLPKVYNTLHCGVAPGGPCNEYTGLGSGGVHWTGGQWHTVGFEVDR
SAGVWYREKLKWYLDGQQVFQIPAARINSSAIWENIAHKGHFILLNVAVGGDWPGQPNAT
TVGGEGVQLEVDYIRVWNYYR

Enzyme Prediction     

No EC number prediction in THC90792.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	56	317	7e-53	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	2.97e-124	52	318	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	4.72e-50	56	317	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	1.38e-19	100	317	28	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185694	GH16_CCF	2.43e-11	90	317	25	329	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
225182	BglS	2.06e-07	41	319	22	265	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58149.1|GH16_3	9.28e-120	44	318	82	381
QKD60230.1|GH16_3	1.59e-117	40	318	18	300
BCS17820.1|GH16_3	8.11e-116	49	318	62	364
CCT75102.1|GH16_3	6.05e-115	38	318	16	300
QGJ01380.1|GH16_3	9.89e-114	38	318	16	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	1.40e-76	43	317	3	278	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	7.77e-64	45	316	5	273	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	3.33e-31	54	318	5	239	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2VY0_A	7.80e-31	52	319	13	261	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
2HYK_A	2.92e-27	54	317	9	242	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23903|E13B_NIACI	7.67e-20	28	317	400	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|Q27082|CFGA_TACTR	2.49e-15	52	317	25	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999756	CS pos: 17-18. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in THC90792.1.