CAZyme Information: THC90683.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC90683.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		47109.44	5.5233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000493:258-1649(+)

Full Sequence      

METDILTSKLEHEKLHLWRDPHSAFFDDHHVYDLKYSLHREREARHYIARYNAPSEPPEH
DNSGSNPLMCASFVTVRRELDDYFDPSIGSLLEGLDPRERRALYLNVLFADTDPTRHPSW
GQNWVDRLTDTSSSYNVSGEQLAHLQAIEKDKDFHEKGVYDYIYALRACQVTNAPYIAIF
EDDIILAEGWMTKTLKALADINHIVQNKTSWIYLRLFYTETALSWTSSDFAYRNMPLIFG
LMMLLTIGCLLVLRRFPICHSYLDYPTVFVISLVCVPAFTALVYMMGKYNIMPLRGVVEM
NTNGCCTQALVFPRAQVDDLVRYLEEKRGQTDLLIEEYAEQTGLTRYALAPPQLQHVGLK
SSRGNADIHTQSTWAFWFEDNDPITLKREHEDLLRSKDIGNILQDHN

Enzyme Prediction     

No EC number prediction in THC90683.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT109	10	395	1.2e-141	0.9391727493917275

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409190	PGAP4-like_fungal	0.0	14	365	20	375	uncharacterized fungal proteins similar to Post-GPI attachment to proteins factor 4. This subfamily contains uncharacterized fungal proteins with similarity to animal post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. Proteins from this subfamily contain the putative catalytic site of PGAP4 and may have similar activities.
409189	PGAP4-like	3.98e-49	18	362	20	361	Post-GPI attachment to proteins factor 4 and similar proteins. This family includes post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. This family also includes uncharacterized fungal proteins with similarity to PGAP4.
409191	PGAP4	7.97e-26	18	362	22	376	Post-GPI attachment to proteins factor 4. Post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246), has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases (GTs), it contains three transmembrane domains. Structural modeling suggests that PGAP4 adopts a GT-A fold split by an insertion of tandem transmembrane domains.
225843	COG3306	2.53e-04	156	238	68	150	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46547.1|GT109	8.93e-184	17	403	47	435
BCR99311.1|GT109	5.60e-180	14	403	44	435
BCS11615.1|GT109	5.60e-180	14	403	44	435
QGA19659.1|GT109	6.93e-163	11	392	40	422
QMW36896.1|GT109	3.61e-143	66	403	2	339

PDB Hits     

THC90683.1 has no PDB hit.

Swiss-Prot Hits     

THC90683.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

Start	End
231	253
265	287