CAZyme Information: THC90315.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC90315.1
• CAZy Family: CBM48
• CAZyme Description: Sialidase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3J671]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	SOSA01000535|CGC1	40037.74	9.9126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000535:17666-18763(+)

Full Sequence      

MASVRLPFTILALFIALILPLAAAAPSPAVKPGVKLDGNPSVMGKGSYPRATYIKDKSLL
GCFRALHDDKVSIETVRSTDKGKTWIPVGTVITEVEKTHGLNNCYLHQLPKSDRILMAFR
NHERDPKTEKYTKYIMSVYYSDDRGKKWEPLSTVATTATRGLGVWEPLMMDDLNGDLMLF
FSRETRKDGKDQNSILVRSTDGGKTWGREETISGGDIQKRDGMLGVTRLAPNSKKMIAVF
ESLTPNTGITSITSSDDGKSWSRDRRTVYKGTNGPPSESAPQVVRVGKTLVASFSTWEDD
RKAGKSKPPNVKIVTSTDGGATWGQKTLVHKNCHWAGEVAIDDKSLLVLCDYNNGAAIAQ
RVSIS

Enzyme Prediction     

No EC number prediction in THC90315.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	45	300	5.1e-50	0.8664495114006515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.14e-13	70	331	44	301	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.12e-11	73	273	113	304	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.27e-10	174	365	24	230	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	4.84e-07	175	361	1	190	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
404074	BNR_2	5.93e-06	116	324	3	199	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX58461.1|GH93	1.05e-150	1	365	1	360
QKX54349.1|GH93	5.25e-70	22	365	29	363
QKX63957.1|GH93	1.51e-66	36	362	35	363
QGA18927.1|GH93	8.00e-64	19	364	20	355
QYS95310.1|GH93	2.74e-51	13	364	6	361

PDB Hits     

THC90315.1 has no PDB hit.

Swiss-Prot Hits     

THC90315.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999786	CS pos: 24-25. Pr: 0.9792

TMHMM  Annotations     

Start	End
7	29