CAZyme Information: THC90002.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC90002.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	SOSA01000574|CGC1	62868.27	6.8485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000574:17060-18833(-)

Full Sequence      

MSRSQVHPPRKILLVVTTGGFTHAGPVLEIGRVLAERGHIIEFATLDGQENWIKRDEYGF
ISGLHLMGPGPTDEQLDDHYRRMQAWDVREGIGPVFISKTMFDSFWPQTYDGLRKIIENP
ATRPNMIIADFFVEAAHDMQVEYNLPLAIVCPNWPPLQLPCSYIPGQPGFQLPGTMTSEN
ASMWLRIKNELIILSDLPAIMRLFKRTRKMRSDHGIFRPLHKPKKPDYLLFVNSFVGLEI
PRDLPPTCAPVGPLLSPTWAPLDEACDSFLKKHKSVLYIALGTHIILPHNDVATIVTGIF
RLMEEVLIDGVIWAIPETGRGDIDGSQTLSTEGDGQSTDLLLGDLLSNKHPDWLFPFFAP
QRAILDHDSTKVYFTHGGGSSANEALFHGKPILSMGIFFDQTANTTRLVAGGVAESLDKV
SFTADEVYTKIKKIVTADENGSYHRNVLRMQRIAHIAARRKNHAADLVEEMMYDNELRFD
ADGRELRPMHLQTADSRMSAFKANNWDMFLVSALGLATIVGSIGLAGHSAWRYRSFLVGQ
TRSIVLEGWGLLQQGRIWPRA

Enzyme Prediction     

No EC number prediction in THC90002.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	79	467	7.3e-26	0.8507853403141361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.68e-38	14	471	4	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	9.34e-14	11	472	3	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	6.09e-12	359	455	330	423	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	1.39e-10	360	465	355	457	ecdysteroid UDP-glucosyltransferase; Provisional
178572	PLN02992	2.63e-09	250	457	236	447	coniferyl-alcohol glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK97035.1|GT1	8.64e-284	1	553	1	550
QQK45460.1|GT1	2.76e-282	1	553	1	549
BCR88254.1|GT1	1.04e-262	6	546	5	542
QKX59607.1|GT1	6.35e-255	1	546	1	542
QLI65751.1|GT1	4.02e-225	9	544	5	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	9.80e-12	358	455	97	191	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
2O6L_A	1.62e-11	358	455	75	169	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
7CJX_A	5.92e-10	358	435	76	153	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2VCE_A	3.07e-09	113	408	97	396	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
5NLM_A	1.64e-08	230	411	216	406	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8JZZ0|UD3A2_MOUSE	2.32e-13	160	435	180	428	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|Q3SY77|UD3A2_HUMAN	9.45e-13	11	435	24	428	UDP-glucuronosyltransferase 3A2 OS=Homo sapiens OX=9606 GN=UGT3A2 PE=2 SV=1
sp|Q6NUS8|UD3A1_HUMAN	2.20e-12	11	435	24	428	UDP-glucuronosyltransferase 3A1 OS=Homo sapiens OX=9606 GN=UGT3A1 PE=2 SV=1
sp|P36513|UDB14_RABIT	5.18e-12	192	455	197	451	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1
sp|P36537|UDB10_HUMAN	6.83e-12	224	455	250	449	UDP-glucuronosyltransferase 2B10 OS=Homo sapiens OX=9606 GN=UGT2B10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000063

TMHMM  Annotations     

Start	End
509	531