CAZyme Information: THC89801.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC89801.1
• CAZy Family: AA7
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A4S3J9Z9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		49938.87	4.5257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000601:16742-18272(+)

Full Sequence      

MPRLWHHWGLLLVASYVTQAIGLHISIGDDQSIKDAASKTAYGSMTWYSGNETGGIPGAF
PTKWWEGSALFLSLLLYWHYTGDTTYNAEVSQGMQHQAGNGDYMPSNYSSYLGNDDQMFW
GVAAMTAAELKFPEVHDGFSWLSLAQGVFNSQAARWDTTTCGGGLRWQIFPYLNGYAMKN
AISNGGFFQLAARLARYTQNQTYTEWAEKVWDWSVSSPLVNNKTWNVADSTNIDNGCKDS
GDNQWSYNYGAYIMGAAYMYNYTEQPKWKEAVDGLLGVTFGTFFPKQFNNIMSEVLCEPN
EVCNDNEILFKGLVVHWLAFTSNLVPSTYDQILPKLQASAQGAANSCSGMNNNTCGVRWY
QNKWDGWVGMEEQIIATEALVSALITEDKAGPVTAKTGGDSKSDPSAGTGGDEDPEDKAK
LKPITTADKAGASILTILFVGVWLSMVAWMFVA

Enzyme Prediction     

No EC number prediction in THC89801.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	394	3e-103	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	32	376	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65580.1|GH76	3.70e-249	1	450	3	452
UDD65266.1|GH76	3.03e-248	23	450	25	452
QRD92992.1|GH76	1.89e-247	23	450	75	502
UDD65265.1|GH76	1.89e-247	23	450	75	502
QMW48108.1|AA3_2|GH76	5.38e-238	23	443	25	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.10e-94	24	408	27	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	2.44e-106	9	436	8	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.58e-103	17	436	13	430	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	4.12e-99	23	452	22	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	8.85e-99	20	408	17	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5ACZ2|DFG5_CANAL	1.83e-97	23	450	22	449	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.081184	0.918790	CS pos: 22-23. Pr: 0.8596

TMHMM  Annotations     

Start	End
430	452